PLANT GENES INVOLVED IN NITRATE UPTAKE AND METABOLISM
Kind Code:
A1
The present invention relates nucleic acid molecules that are modulated (e.g., upregulated) by nitrogen in corn, to proteins or polypeptides encoded by these nucleic acid molecules, and promoters of these nucleic acid molecules. The present invention relates to a nucleic acid construct having a nucleic acid molecule that is modulated by nitrogen in corn, as well as to expression systems, host cells, plants, and plant seeds having the nucleic acid construct. The present invention also relates to a method of expressing the nucleic acid molecule that is modulated by nitrogen in a plant by growing a transgenic plant or a plant grown from a transgenic seed transformed with the construct. The present invention further relates to an isolated DNA promoter that can be used to direct nitrogen-regulated expression of an isolated nucleic acid in plants.

Inventors:
Schnable, Patrick S. (Ames, IA, US)
Dash, Sudhansu (Ames, IA, US)
Application Number:
11/876534
Publication Date:
06/12/2008
Filing Date:
10/22/2007
View Patent Images:
Export Citation:
Assignee:
IOWA STATE UNIVERSITY RESEARCH FOUNDATION, INC. (Ames, IA, US)
Primary Class:
Other Classes:
800/309, 800/310, 800/294, 800/320.3, 800/317.1, 536/23.6, 800/316, 800/305, 800/307, 800/293, 800/315, 435/320.1, 435/252.3, 800/323.2, 800/322, 536/24.1, 800/317.3, 800/292, 800/320, 530/350, 800/278, 800/323.3, 800/320.1, 800/313, 800/317.4, 800/306, 800/323.1, 800/317.2, 800/312, 435/410, 800/298
International Classes:
A01H5/00; C07H21/00; C07K14/00; C12N1/20; C12N15/00; C12N15/82; C12N5/04
Attorney, Agent or Firm:
NIXON PEABODY LLP - PATENT GROUP (1100 CLINTON SQUARE, ROCHESTER, NY, 14604, US)
Claims:
What is claimed:

1. A nucleic acid construct comprising: a nucleic acid molecule that is modulated by nitrogen in corn; a 5′ DNA promoter sequence; and a 3′ terminator sequence, wherein the nucleic acid molecule, the DNA promoter sequence, and the terminator sequence are operatively coupled to permit transcription of the nucleic acid molecule.

2. The nucleic acid construct according to claim 1, wherein the nucleic acid molecule either: (a) encodes a polypeptide having an amino acid sequence selected from the group consisting of SEQ ID NO:2, SEQ ID NO:5, SEQ ID NO:8, SEQ ID NO:11, SEQ ID NO:14, SEQ ID NO:17, SEQ ID NO:20, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:28, SEQ ID NO:31, SEQ ID NO:32, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:40, SEQ ID NO:43, and SEQ ID NO:45; or (b) comprises a nucleotide sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:4, SEQ ID NO:7, SEQ ID NO:10, SEQ ID NO:13, SEQ ID NO:16, SEQ ID NO:19, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:27, SEQ ID NO:30, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:39, SEQ ID NO:42, and SEQ ID NO:44; or (c) comprises a coding portion of a nucleotide sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:4, SEQ ID NO:7, SEQ ID NO:10, SEQ ID NO:13, SEQ ID NO:16, SEQ ID NO:19, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:27, SEQ ID NO:30, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:39, SEQ ID NO:42, and SEQ ID NO:44.

3. The nucleic acid construct according to claim 1, wherein the DNA promoter sequence is a constitutive plant promoter.

4. The nucleic acid construct according to claim 1, wherein the DNA promoter sequence is an inducible plant promoter.

5. The nucleic acid construct according to claim 4, wherein the inducible plant promoter is a nitrogen inducible plant promoter.

6. The nucleic acid construct according to claim 5, wherein the nitrogen inducible plant promoter comprises a nucleotide sequence selected from the group consisting of SEQ ID NO:3, SEQ ID NO:6, SEQ ID NO:9, SEQ ID NO:12, SEQ ID NO:15, SEQ ID NO:18, SEQ ID NO:21, SEQ ID NO:26, SEQ ID NO:29, SEQ ID NO:33, SEQ ID NO:38, SEQ ID NO:41, and SEQ ID NO:46.

7. The nucleic acid construct according to claim 1, wherein the DNA promoter sequence is a tissue-specific promoter.

8. The nucleic acid construct according to claim 1, wherein the DNA promoter sequence is an organ-specific promoter.

9. An expression vector comprising the nucleic acid construct according to claim 1.

10. A host cell transformed with the nucleic acid construct according to claim 1.

11. The host cell according to claim 10, wherein the host cell is a bacterial cell or a plant cell.

12. The host cell according to claim 11, wherein the host cell is a plant cell.

13. A plant transformed with the nucleic acid construct according to claim 1.

14. The plant according to claim 13, wherein the plant is selected from the group consisting of nice, corn, soybean, canola, potato, wheat, mung bean, alfalfa, barley, rye, cotton, sunflower, peanut, sweet potato, bean, pea, chicory, lettuce, endive, cabbage, brussel sprout, beet, parsnip, turnip, cauliflower, broccoli, radish, spinach, onion, garlic, eggplant, pepper, celery, carrot, squash, pumpkin, zucchini, cucumber, apple, pear, melon, citrus, strawberry, grape, raspberry, pineapple, tobacco, tomato, sorghum, sugarcane, banana, Arabidopsis thaliana, Saintpaulia, petunia, pelargonium, poinsettia, chrysanthemum, carnation, crocus, marigold, daffodil, pine, Medicago truncatula, Sandersonia aurantiaca, and zinnia.

15. A component part of the plant according to claim 13.

16. A fruit of the plant according to claim 13.

17. A plant seed produced from the plant according to claim 13.

18. A plant seed transformed with the nucleic acid construct according to claim 1.

19. A method of expressing a nucleic acid molecule modulated by nitrogen in a plant, said method comprising: providing a transgenic plant or plant seed transformed with a nucleic acid construct according to claim 1 and growing the transgenic plant or a plant grown from the transgenic plant seed under conditions effective to express the nucleic acid molecule in said transgenic plant or said plant grown from the transgenic plant seed.

20. The method according to claim 19, wherein said growing is effective in reducing nitrogen uptake of said transgenic plant or said plant grown from the transgenic plant seed.

21. The method according to claim 19, wherein said growing is effective in increasing nitrogen uptake of said transgenic plant or said plant grown from the transgenic plant seed.

22. The method according to claim 19, wherein said growing is effective in increasing efficiency of nitrogen utilization of said transgenic plant or said plant grown from the transgenic plant seed.

23. The method according to claim 19, wherein a transgenic plant is provided.

24. The method according to claim 19, wherein a transgenic plant seed is provided.

25. The method according to claim 19, wherein the plant is selected from the group consisting of rice, corn, soybean, canola, potato, wheat, mung bean, alfalfa, barley, rye, cotton, sunflower, peanut, sweet potato, bean, pea, chicory, lettuce, endive, cabbage, brussel sprout, beet, parsnip, turnip, cauliflower, broccoli, radish, spinach, onion, garlic, eggplant, pepper, celery, carrot, squash, pumpkin, zucchini, cucumber, apple, pear, melon, citrus, strawberry, grape, raspberry, pineapple, tobacco, tomato, sorghum, sugarcane, banana, Arabidopsis thaliana, Saintpaulia, petunia, pelargonium, poinsettia, chrysanthemum, carnation, crocus, marigold, daffodil, pine, Medicago truncatula, Sandersonia aurantiaca, and zinnia.

26. The method according to claim 19, wherein said providing comprises transforming a non-transgenic plant or a non-transgenic plant seed with the nucleic acid construct to yield said transgenic plant or plant seed.

27. The method according to claim 26, wherein said transforming comprises Agrobacterium-mediated transformation, whisker method transformation, vacuum infiltration, biolistic transformation, electroporation, micro-injection, polyethylene-mediated transformation, or laser-beam transformation.

28. An isolated DNA promoter from corn suitable for inducing nitrogen-regulated expression of a protein encoded by an isolated DNA molecule operably associated with the DNA promoter, wherein said DNA promoter comprises a nucleotide sequence selected from the group consisting of SEQ ID NO:3, SEQ ID NO:6, SEQ ID NO:9, SEQ ID NO:12, SEQ ID NO:15, SEQ ID NO:18, SEQ ID NO:21, SEQ ID NO:26, SEQ ID NO:29, SEQ ID NO:33, SEQ ID NO:38, SEQ ID NO:41, and SEQ ID NO:46.

29. A nucleic acid construct comprising: an isolated nucleic acid molecule encoding a protein; an isolated DNA promoter according to claim 28, wherein the DNA promoter is operably linked 5′ to the isolated nucleic acid molecule to induce transcription of the nucleic acid molecule; and a 3′ terminator sequence operably linked to the isolated nucleic acid molecule.

30. An expression vector comprising the nucleic acid construct according to claim 29.

31. A host cell transformed with the nucleic acid construct according to claim 29.

32. A plant transformed with the nucleic acid construct according to claim 29.

33. A plant seed produced from the plant according to claim 32.

34. A plant seed transformed with the nucleic acid construct according to claim 29.

35. A method of directing nitrogen-regulated expression of an isolated nucleic acid in plants, said method comprising: transforming a plant cell with a nucleic acid construct according to claim 29 and regenerating a plant from the transformed plant cell, wherein expression of the nucleic acid molecule, under control of the DNA promoter, occurs in the plant and is upregulated by nitrogen.

36. An isolated nucleic acid molecule that is modulated by nitrogen in corn, wherein said nucleic acid molecule comprises: a nucleotide sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:4, SEQ ID NO:7, SEQ ID NO:10, SEQ ID NO:13, SEQ ID NO:16, SEQ ID NO:19, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:27, SEQ ID NO:30, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:39, SEQ ID NO:42, and SEQ ID NO:44; or a coding portion of a nucleotide sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:4, SEQ ID NO:7, SEQ ID NO:10, SEQ ID NO:13, SEQ ID NO:16, SEQ ID NO:19, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:27, SEQ ID NO:30, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:39, SEQ ID NO:42, and SEQ ID NO:44.

37. An isolated protein or polypeptide, wherein said isolated protein or polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID NO:2, SEQ ID NO:5, SEQ ID NO:8, SEQ ID NO:11, SEQ ID NO:14, SEQ ID NO:17, SEQ ID NO:20, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:28, SEQ ID NO:31, SEQ ID NO:32, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:40, SEQ ID NO:43, and SEQ ID NO:45.

Description:

This application claims the benefit of U.S. Provisional Patent Application Ser. No. 60/869,290, filed Dec. 8, 2006.

FIELD OF THE INVENTION

The present invention relates to plant genes involved in nitrate uptake and metabolism.

BACKGROUND OF THE INVENTION

Nitrogen plays an important role in various plant functions, including metabolism, resource allocation, growth, and development (Crawford, N. M., “Nitrate: Nutrient and Signal for Plant Growth,” Plant Cell 7:859-868 (1995); Marschner, M., Mineral Nutrition of Higher Plants, 2d ed., Academic Press Ltd.: London (1995); and Stiit et al., “The Molecular Physiological Basis for the Interaction Between Elevated Carbon Dioxide and Nutrients,” Plant Cell Environ. 22:583-622 (1999)). Further, nitrogen is a major component of proteins and nucleic acids, as well as various secondary metabolites found in plants (Marschner, M., Mineral Nutrition of Higher Plants, 2d ed., Academic Press Ltd.: London (1995)). Therefore, nitrogen is one of the most important inorganic nutrients of plants. Inorganic nitrogen is added to many crop plants in the form of nitrogenous fertilizers (see Frink et al., “Nitrogen Fertilizer: Retrospect and Prospect,” Proc. Natl. Acad. Sci. USA 96:1175-1180 (1999)). Nitrogen is principally added to the soil in the form of ammonia (NH 4 + ) and nitrate (NO 3 ). However, estimates of nitrogen uptake efficency have shown that between 50 and 70 percent of the applied nitrogen is lost from the plant-soil system (Peoples et al., “Minimizing Gaseous Losses of Nitrogen,” In Nitrogen Fertilizer in the Environment, Bacon, P. E., ed., Marcel Dekker, pp. 565-606 (1995)).

The application of inorganic nutrient fertilizers is one of the major expenses incurred by producers of high-yielding crop plants (see Good et al., “Can Less Yield More? Is Reducing Nutrient Input Into the Environment Compatible with Maintaining Crop Production?” Trends in Plant Science 9(12):597-605 (2004)). Further, reports have indicated that nitrogen-based fertilizers may be associated with environmental damage (see Vitousek et al., “Human Alternation of the Global Nitrogen Cycle: Causes and Consequences,” Ecol. Appl. 7:737-750 (1997)). Therefore, one important way of decreasing the amount of inorganic nitrogen that is applied to plant crops is to develop ways to improve nitrate use efficiency (“NUE”) in plants.

Traditional plant breeding and marker-assisted selection are techniques that have been investigated for developing and identifying plants with increased NUE (see Good et al., “Can Less Yield More? Is Reducing Nutrient Input Into the Environment Compatible with Maintaining Crop Production?” Trends in Plant Science 9(12):597-605 (2004)). However, these approaches are often time-consuming and labor-intensive. An alternative approach is to use genetic engineering techniques to develop transgenic crop plants that have enhanced NUE. This approach requires the identification of genes that enhance NUE. Efforts have been reported regarding identifying genes that are regulated by nitrogen levels in Arabidopsis (Scheible et al., “Genome-Wide Reprogramming of Primary and Secondary Metabolism, Protein Synthesis, Cellular Growth Processes, and the Regulatory Infrastructure of Arabidopsis in Response to Nitrogen,” Plant Physiol. 136:2483-2499 (2004)). However, there is a need to identify genes that are involved in nitrate uptake and metabolism in economically important crop plants such as corn.

The present invention is directed to overcoming these and other deficiencies in the art.

SUMMARY OF THE INVENTION

The present invention relates to nucleic acid molecules from corn (maize) that are modulated by nitrogen (e.g., that up-regulated by nitrogen). The present invention also relates to isolated proteins or polypeptides encoded by the nucleic acid molecues. The present invention further relates to promoters of the nucleic acid molecules of the present invention.

The present invention further relates to a nucleic acid construct having a nucleic acid molecule of the present invention (i.e., a nucleic acid molecule that is modulated, e.g., up-regulated, by nitrogen in corn). The construct also includes a 5′ DNA promoter sequence and a 3′ terminator sequence. The nucleic acid molecule, the DNA promoter sequence, and the terminator sequence are operatively coupled to permit transcription of the nucleic acid molecule.

The present invention also relates to an expression system, host cells, plant cells, plants, and plant seeds having a nucleic acid construct that includes a nucleic acid molecule that is modulated by nitrogen in corn.

Another aspect of the present invention is a method of expressing a nucleic acid molecule that is modulated by nitrogen in a plant. This method involves providing a transgenic plant or plant seed transformed with a nucleic acid construct having a nucleic acid molecule that is modulated by nitrogen in corn, a 5′ DNA promoter sequence, and a 3′ terminator sequence. The method involves growing the transgenic plant or a transgenic plant grown from the transgenic plant seed under conditions effective to express the nucleic acid molecule in the transgenic plant or the plant grown from the transgenic plant seed.

Another aspect of the present invention relates to an isolated DNA promoter from corn suitable for inducing nitrogen-regulated expression of a protein encoded by an isolated DNA molecule operably associated with the DNA promoter. The present invention further relates to a nucleic acid construct including the isolated DNA promoter, as well as expression vectors, host cells, plants, and plant seeds containing the nucleic acid construct. The present invention also relates to a method of directing nitrogen-regulated expression of an isolated nucleic acid in plants. This method involves transforming a plant cell with the nucleic acid construct described in this paragraph and regenerating a plant from the transformed plant cell. By this method, expression of the nucleic acid molecule, under control of the DNA promoter, occurs in the plant and is upregulated by nitrogen.

Nitrate use efficiency affects both grower profitability and the ecological sustainability of intensive corn production. The present invention is effective in providing a means to improve the NUE by enhancing the nitrogen uptake of crop plants such as corn. In particular, the nucleic acid constructs of the present invention can be used to develop corn germplasm using marker-assisted selection and/or transgenic approaches. Thus, the present invention is useful in increasing the nitrate absorption and usage efficiency by crop plants and thus reduce the use of nitrate supplements. The nucleic acid constructs of the present invention include nucleic acid molecules corresponding to genes of corn plants and, hence, have the most direct bearing on nitrate metabolism in corn. Therefore, such genes may be more directly relevant to corn improvement than genes from non-crop plants such as Arabidopsis.

DETAILED DESCRIPTION OF THE INVENTION

The present invention relates to nucleic acid molecules (e.g., genes) from corn (maize) (e.g., from B73 seedlings) that are modulated (e.g., up-regulated) by nitrogen (e.g., in the form of nitrate, calcium nitrate, etc.). These genes and their promoters are natural targets for use in corn improvement. These genes can be used to improve corn germplasm with the use of marker-assisted selection and/or transgenic approaches. The present invention provides nucleotide sequences of the full-length cDNA clones of such genes. The present invention also provides the amino acid sequences of the isolated proteins or polypeptides encoded by these genes, as well as their putative promoters (upstream of transcription start site of the genes).

A suitable nucleic acid molecule of the present invention is a gene that is up-regulated by nitrogen and contained in a full-length cDNA clone having the nucleotide sequence of SEQ ID NO:1, as follows:

CGACTGGAGCACGAGGACACTGACATGGACGGAAGGAGTAGAAA ATATT
GCCTGCTCCGACGACCTTGAATATTCACTGGCCATTTAATTTCTACTTAC
AAGCCTGAATGAGCTAGAGATCCATCTGCTTCTGTACGTGCTCGTCAGGT
ACGCTCGTAAAAAGAAAAGAAAAAAAAAGAAGAGATCGAGATCGATCTGT
TGACGACGCCCCCGTCGCCGAT ATG GGCGACCTCTCTGTCGGCCACAGC
CGCCGCTGGTGCGGCCGTTTCGCGGCCGTCCTTTGCCTGTGCGCGGC
CTTCTGCAAGCCAGATGAACTCCCGATGGATCCACTGCCGAACTTGC
CGCCGACGAGGTCGCTGCAGTGCTTCGAGGACGAACAGGTGTACAGC
TGCTGCGAGGGCGCGTACAGGCTAAACCCATCGGGAATCATCGCCGT
TCCCGTCGGCGCGGTGGACTACTACTGCGGCGGCGCGTGCGTGGTGG
AGACGGAGGACGTGCTCAACTGCGTGGCCAGCGCCCTGGACGGCTTC
GCCTTCTACAACGGGGCCTCCGTGGAGGACGTGCGCTACGCACTCAG
GCGGGGCTGCAGCCACACCGCCAGAAGAGGCGACTTCAACGATTTGG
AGCCGCATCTGGGCGACTACCCTGACATCTATGGCGACGATGATGAG
CACAGCTTTGGCAGCAAGGTTGTTGCAGCTCCTCTGAGGTTGCTCGC
GTTTCTTGGCGGTGCGGGGCTGTTCTTCCTGGGCCCTTGA

(Underlined=GeneRacer Oligo sequence; Bold/Underlined=start codon; coding sequence in bold) (Sequence of 5′ RACE product CW13E07-Full_Length cloned into pCR4-TOPO) (derived from MEST13-E07, GB_ACC# BG840928).

The predicted protein or polypeptide encoded by the full-length cDNA clone of SEQ ID NO:1 has an amino acid sequence of SEQ ID NO:2, as follows:

MGDLSVGHSRRWCGRFAAVLCLCAAFCKPDELPMDPLPNLPPTRSLQCFE
DEQVYSCCEGAYRLNPSGIIAVPVGAVDYYCGGACVVETEDVLNCVASAL
DGFAFYNGASVEDVRYALRRGCSHTARRGDFNDLEPHLGDYPDIYGDDDE
HSFGSKVVAAPLRLLAFLGGAGLFFLGP

A putative promoter (upstream of the transcription site of the gene) for the gene of the full-length cDNA clone of SEQ ID NO:1 has a nucleotide sequence of SEQ ID NO:3, as follows:

ccgcaagagggagtctttaccgagtgtcacctaatacgcttggcgaaggacctggt aaaagggcccac
agggagctttttgctaagtgtctgtacagtggacactcggcaaagagtgagccttt gccgagtgtcac
tccgtcaccgttacctggtgtcgtgacgacggcttttctttgtcgagtaccgagtg acactcgacaaa
acctttgccgagcgtccgataaaaagtattcggcaaagaagccgttgccgtctttg ccgagtgttttc
cagactttgccgagtgtttcagacactcggcaaagaacctgattccgatagtgaag gtcttacacccc
gatccaccccaattcgtgcgtattggagcaagtacccaaacaaaaccgtactggga ataattacctcc
gttcgctgcagtttgcagaacagcagttcaatgctacaggacgacgcagctgcagc gaacatgcatgc
atttgaactcactccgttcactgatggacaagaggcatctgggtgactaataaaag aacgacacacac
ggacagcttctagaagtattggtagcgcatgaacaacaatgccgctgttagcttgt actgaggcacga
aacatgaatctgacctactactgacttctactataataatagtatatagtatggcc aggccaggccaa
ctccggcgaaaacgggagtacgcatgcagatggagcggcacattagtaggctgttt ggtttgaagaat
gggctagtctatcatcttctcactctccacttttttgtttggtttgtggaatgaaa tgagttgattca
tcatcacctcattccttatagttagttagttagtactaatatgaggaatatggtca tcccaccaaatt
tgaggaatggatccacgatgtaccaccacattttgcatgaagtgattcctcaaacc aaacacccccaa
atgtaaaccgagtcatgcctccgatcccaaccttcgtgtttcccaccaaacacacg cgtacagaggcc
aagcacacgcacaaaagcaagcctcgatcgtagcccgtgcctaaccctgccgatgc cgtaataaactt
gtgtgctccacgcaaccatgaaatgaacctagaaatcgcaggggcgggatgcgagt gaaaaggagcgg
gcaggtcaggtaggtttgaactctctcctataataatcctagctagcacacttgcc cagattatattg
cctgctccgacgaccttgaatattcactggccatttaatttctacttacaagcctg aatgagctagag
atccatctgcttctgtacgtgctcgtcaggtacgctcgtaaaaagaaaagaaaaaa aaagaagagatc
gagatcgatctgttgacgacgcccccgtcgccgatatgggcgacctctctgtcggc cacagccgccgc
tggtgcggccgtttcgcggccgtcctttgcctgtgcgcggccttctgcaagccagg tgcgtgctcacc
gtcaacacacgcaccattattccaccctcccaaggagcacagtacaacgcacgtac atatacctctcc
tcaatcgatatatagttacgtcttacgtactatctagttaatctatcacgttgatg tctaatatagac
tccgcatggcatatgcatgcagatgaactcccgatggatccactgccgaacttgcc gccgacgaggtc
gctgcagtgcttcgaggacgaacaggtaagctaacaagcaagagcgtgtttggttt catgctaggaca
gagttgcataccacgtagctatcataagcctaccacacgtagctatcacagcctgt cgatttcgttcg
gtcgcctgacggtaaacatcgctgcccgagaggcgagctctttttgacaagcctcg acgaaccaaata
agccaagtcctactgtacgagggcgatcgaggcgccgaggcctgtgtgatgtgatg ccgtgtgtcgtg
gtcacccaccagctgctgtgtacattggtccccgtgccgcgcgtcgtaaccgcatg cggcatgccgct
gcatgcaggtgtacagctgctgcgagggcgcgtacaggctaaacccatcgggaatc atcgccgttccc
gtcggcgcggtggactactactgcggcggcgcgtgcgtggtggagacggaggacgt gctcaactgcgt
ggccagcgccctggacggcttcgccttctacaacggggcctccgtggaggacgtgc gctacgcactca
ggcggggctgcagccacaccgccagaagaggtccccaagtttctcgcctactagct catctctctcta
cgtaccagccaagctagatcgactaccagtctccgcagcagtgcattcggaacgac cgctgacaaact
gacaggctcgtgttcctgtcagcgcaggcgacttcaacgatttggagccgcatctg ggcgactaccct
gacatctatggcgacgatgatgaacacagctttggcagcaaggttgttgcagctcc tctgaggttgct
cgcgtttattggcggtgcggggctgttcttcctgggcccttgaacgaagatataaa agaactagcgat
gtgatccgcgtaaatatatactccgtatatagcatgacatgagtatctagtttgtc ttatatggtaaa
ccatactaaattttcttgtatggcattaaaaaaaattaagactttatttagttatt tgactagttgtt
ctctctggatcctctaatcagttcgaactctataagcttttttattccactcctat ctagaggtcgca
taatatgctaaggtgagatcttgatgtctttcgtttttttaactcgataaagttgt tgtgagtctctc
ttataaaattatttttaatgctaatattagattttagtcagagatatgcagttgac cgttttgcacta
aaatatttttgaatttactatagtattagttgtctactaatcacagctaaaaccgt ttttatttttag
tttttttataacagaaaaaatatctctggaaacgaaaacggcaacacagtagttca aaaatatcgaag
acaataatttaacatgaaaaatatatatgtaatgatcggaatctaaaaaacaatca ctaaatataaac
atatagtaacatgtactctcaattgacctgaaaaaagcacataacctatagatcca caaagtaacgaa
gattgaagcatgaaaaatagaccatcatacattaaagggttgtgcttatttagctc tagaataacctc
cttaagagcaacttcatttgcaacaacattgtctagagttaaagagaatattttct tctctgtaaacc
atttcaataagcatgaactgggtctaagagacaaattcttaccgttgtgccgaccc agaacatgatcg
aaatttgtaattcgcttctgtatttgtgaatcatcatctacccaatgtaccatgat acacatgtacct
tttattctgatttgatatccacatctccatggtagcactgaagtgacaattaaggg ttttaaaaaatt
tatacaacacatcatttttatgcaaaagagatccattacttcttttctaacaatga catgtgacttta
tagaaaatataggctttaaaggtttaatgaaatccataaagtattcatgttcaaga atgttaaatggg
tactcatgaatgataatagtagtataaaacttcctcaaactaattgactcgtcata tttatatggttg
gacaatatatagatatacctaccttatgatctttttctgatttgagctcctgctat cttagtaaaacc
ttatgataacgcttctaatgcaaccaaaactaagttgttcctctatggcttttagc actacctttgta
agtcctatttttgtagctcagaaactttcatttggcccaaatttgctccagagatt tgcaattcccct
ccactacaacaacatacaaatcaaaatactgccaaacatctaaagtatacttattt gctactttatgg
ggtgctcatcaacattagattcact

(>MAGI4 8075 MAGI4.contigs_w_singleton.fas 4037 bp).

A suitable nucleic acid molecule of the present invention is a gene that is up-regulated by nitrogen and contained in a full-length cDNA clone having the nucleotide sequence of SEQ ID NO:4, as follows:

GGACACTGACATGGACTGAAGGAGTAGAAA ATACAGAACCCTGCAACTG
CAAGCTAAGGAGAGTGTGATCACCAACAGCTAGTGCTAGTCCCCCTTCCT
TCCATCCATCC ATG GCATGCGTCAGCACCTTCCAGAGCTGCCCCATTG
CCAGAAGAGCAAAGATCAACACCAGGTCCAGGGGCAGCAGCAGTAGC
GTGGCGAAGGGGTCACCACCACCAGCCTTCCAGTTCCAGTGCAGGGC
GTCGACTTTCGCGGCGGACACCAGCCTCCGGCTCGAGCTGGACGAGA
ACCCCGAGGCGATCATCTCGGGGGCGTGGCCCGGGAACTGCTCCCTC
CTCAGCTACGACGACCTCCGCGCCTACCTCGAGTCGCAGGAGACGGC
GGCCCAGGCAGACGATCAGCGCGGCGTGGCGCTCCTGAGCGAGACC
ATGTCCACACCCGTGCTGGTGGCCACAGCAGACCAGACCCTGGAGGA
CGTCGAGTGCCACTTCGAGGCCGTGTCGGGGCTTCCGGTCGTCGACA
GCGGCCTCAGATGCGTCGGGGTGATCGTCAAGAACGACCGGGCAAGA
GCCTCTCATGGGTCCAAGACGAAGATATCGGAAGTGATGACATCTCC
AGCTATCACACTATCGTCTGACAAAACCGTGATGGATGCTGCTGTTCT
CATGCTCAAGAAGAAGATCCACAGATTACCAGTTGTAAACCAGGACG
AAAAAGTAATAGGTATAGTTACCCGCGCTGATGTTCTTCGCGTGTTGG
AAGGCATGTTGAAGATTTAG GAGCGCAGATACCCATGCTCGGAAGCCAC
AGCCTCTTGTAAATATGTAGATGTGCCCGGGCATGGTGTTTCTGAGTAGC
AGCAAAGAGATCTACCATGTATAGGAGTTTCTCCTTGTAAATAATAGTAG
CACGCCAGGAGACTCCATCCCAGG

(Underlined=GeneRacer Oligo sequence; Bold/Underlined=start codon; coding sequence in bold) (Sequence of 5′ RACE product CW13A08-Full_Length cloned into pCR4-TOPO) (derived from MEST13-A08, GB_ACC# BG840889).

The predicted protein or polypeptide encoded by the full-length cDNA clone of SEQ ID NO:4 has an amino acid sequence of SEQ ID NO:5, as follows:

MACVSTFQSCPIARRAKINTRSRGSSSSVAKGSPPPAFQFQCRASTFAAD
TSLRLELDENPEAIISGAWPGNCSLLSYDDLRAYLESQETAAQADDQRGV
ALLSETMSTPVLVATADQTLEDVECHFEAVSGLPVVDSGLRCVGVIVKND
RARASHGSKTKISEVMTSPAITLSSDKTVMDAAVLMLKKKIHRLPVVNQD
EKVIGIVTRADVLRVLEGMLKI

A putative promoter (upstream of the transcription site of the gene) for the gene of the full-length cDNA clone of SEQ ID NO:4 has a nucleotide sequence of SEQ ID NO:6, as follows:

caacgtggagtaggcaagcgttggtcttggccgaaccacgggataaaccactgtgt caactctgtgat
tgatctcttgtggtattgtgttttgttgagactcttttctagccacttggcattta gtgtgctaacac
ttaacaagtttttgtggctataagtttaagttttacaggatcacctattcaccccc cccccctctagg
tgctctcaagttgacaggtgtctccatggtgcctaattgagccgttcttttacgct atccattcgatt
ggtttggtgggtatgtgtggtctggctcttgcgatgtttgcccgctggaaacgaaa caatcgtgcata
cgtgcgcatgcaattaacggtggtgtttttggcctgtcttgcagcagcgggtgcag cattggcttggc
ataagcacgcaaccaaacaaagactaccttttggtcaatgcatgcgaagaatctgt acgagcgggcgt
agacaaccaatgatgcgatataaaatttaaggattgaatcatattagaatcgagct ttatttctattc
attttcgaactaattttttaagtatcctaacttattgtgaagaaacgtaaatattt agatcccgatcc
attaccacctctactcatacgtgaaaccaaacacgcggaatatccttctggttcaa atatgcagaagt
caatgagcaggacttctgcttgtttgttcagtctctcaggcagggttacaggaggc aatacaagatgt
tctccaacgattccctgaatcgttcaccccctctctcagtcctatgattcactcac tcacccctcccc
ctcttctccgtatgacaggaaatccccctagagggggagagctctaagctccccct ccactaattaat
catatttactgtgaaattacctatttgtagtgtaattaatagttagcaatgtgtat tacgtattataa
atattgtaccaatatttaaaactcaaaaaactaatgtataaaaatcaaatagtgca cttaaagtatta
agggcagagctgaatagggggattgttggagaagtgaagaaatagggggaagaata gttgagaagggg
tatttaaatatgaatagaaagtatgaatggagggaatgtttggagagagctcaaga acaagggacact
gagctgcctacaacacgtggccctttttgtccctcttcttttttttctttcgcatc tgctggctacaa
gaggacacgcccttctattcgccgtatagagcagtgtctgtgaagtaaaagagaac tatcctccaagg
cttattttgagtgtattactcctggattcttgaatcttagctggtatggtatggta aggagttacgtt
gtccaggagattccaacttacggatccacactgaaaagtttgtattacccatttgt taggccccgttt
caatctcacgggataaactttagcttcctgctaaactttagctatgtgaattgaag tgctaaagttta
gttttaattaccaccattagctttcctgtttagattacaaatggctaaaagtagct aaaaaaagctgc
taaagtttatctcgcaagattggaacagggcctatatggtcactttagagaggcat ggaggtttaata
gactatgacattcgtacgtggtcacctcaacaaactttattgtttgaccgaaccat agattgaattgt
gtgacattgttctttgctcgtattattattaatagaaagtaaccttcttgggtgcg gcccatacggtc
ctgagcgcactaaatgaggcctcattggccgcggcccattcgatcctcaacgcact ggataaagccag
cgtggcgtggctaaaccacttcgtttggcatgggcctgtcggtgcacttgcccaaa ccatgagcttgt
accaaaactcgctagtggtagtggtattagtagtgaagaacttctgcaacttcaaa ctcaccgattct
ctcgcggtcagtttggaagctaaaatatcggtggaaattagagagaatttgataag ctaaaatctctt
tattatttaaaattgaataataaataaattttaactcctccaatcttctccgtttt tatgtctcccaa
actcagtgtaccagatcatattcctttcattaaaaaaaaggtgaacaaagacgcca ccttatccactg
ccacgtgacagggggccaggggaatctcggcggccagtggcggcacgccacgccgg ccggtcgccccc
gtcgctgtacaagatacccatgattggagcggggcaggtgcagagcagcaacgcca cggctgcatgag
atcaagaagctgccttcacttcgcccactgcagcatgccgtgtcgccgtcagagtt gggcgcatatcc
agataaaaaaaacttgcctgcttgcactgcagatgcgttgtttttgctaacagcaa gcaggcaagtca
gcagcctaaccttctttgatatttacagagaagatgaaaaggagaactggagagca gtagtggcagtc
acttcactggtcaagcattcctatccacctcggcccacctccacctccctgacagt cattttgttata
taaaacccatcaagctcccctgcaaggagatacagaaccctgcaactgcaagctaa ggagagtgtgat
caccaacagctagtgctagtcccccttccttccatccatccatggcatgcgtcagc accttccagagc
tgccccattgccagaagagcaaagatcaacaccaggtccaggggcagcagcagtag cgtggcgaaggg
gtcaccaccaccagccttccagttccagtgcagggcgtcgactttcgcggcggaca ccagcctccggc
tcgagctggacgagaaccccgaggcgatcatctcgggggcgtggcccgggaactgc tccctcctcagc
tacgacgacctccgcgcctacctcgagtcgcaggagacggcggcccaggcagacga tcaggtacactt
cgatctcgcggcttcttcagttcttgttaccattgtttacatctcctccagctctt gctaacccggcc
tggacgggtctcctcctctgtggatatatacagcgcggcgtggcgctcctgagcga gaccatgtccac
acccgtgctggtggccacagcagaccagaccctggaggacgtcgagtgccacttcg aggccgtgtcgg
ggcttccggtcgtcgacagcggcctcagatgcgtcggggtgatcgtcaagaacgac cgggcaagagcc
tctcatggggtcagcacctcgctcctctccctccacctctttctttctcatggggc cagggccatgca
tgcgcatcaagctgctagtttctcatagacaggcaaataagaacgacgtacgtccg ttcagtttaccg
gtctgtttctacttgtgacagtccaagacgaagatatcggaagtgatgacatctcc agctatcacact
atcgtctgacaaaaccgtgatgggtaatcttttttgcatcgcttttcttttctttt cttttcttttct
gttcatgtgtgatttttaacaagttgaatctaacagtgcatgcctaacgtctacag atgctgctgttc
tcatgctcaagaagaagatccacagattaccagttgtaaaccaggacgaaaaagta ataggtacggtg
agtgagtgtcagaatgctcacaagccagcagagattaaaaaaaaaaactgcatgcc atacacttaatt
agtattatccttaattatcattgacaacacagagattatatgttgcaagggctaat ggggttctaaac
actgtcaacaggtatagttacccgcgctgatgttcttcgcgtgttggaaggcatgt tgaagatttagg
agcgcagatacccatgctcggaagccacagcctcttgtaaatatgtagatgtgccc gggcatggtgtt
tctgagtagcagcaaagagatctaccatgtataggagttctcc

(>MAGI4 31359 MAGI4.contigs_w_singleton.fas 3987 bp).

A suitable nucleic acid molecule of the present invention is a gene that is up-regulated by nitrogen and contained in a full-length EDNA clone having the nucleotide sequence of SEQ ID NO:7, as follows:

CGACTGGAGCACGAGGACACTGACATGGACTGAAGGAGTAGAAA CCCTT
CTCGCTCGGTTGCTCGGGAGCTTTCCCCTTCCTGTTCCTGAAGCTTCCGA
CATCCGACCGCCTCCTCCTCCTCGTTCTACTCGCCGCCCCTTCTAGAATC
ATCCAGAGGCGTGCCGGTGAAGCGCGAGAGCGGTGAGGC ATG GCGATGC
AGACGGGGGTCGCGACCTCCAAGGTCCTCATCCTCGTCGGTGCAGGGAT
GACGGGCTCGATCCTGCTGCGGAATGGCCGCTTATCTGATGTGTTGG
GAGAACTCCAGGAGATTATGAAGGGTGTAAATCAAGGAACTTCTTCG
GGTCCCTATGACATTGCACTTATTCAAGCTCAGATTCGGAATTTAGCG
CAAGAAGTCAGAGATTTGACATTGTCAAAGCCCATTACCATACTGAAT
GGCAAATCTGACTCGGGAGGCAGTTTATCATCCTACATACTGCCAGC
AGCAGCAGTTGGAGCAATGGGTTATTGCTACATGTGGTGGAAGGGGT
TGTCTCTCTCAGATGTCATGTTTGTCACAAAACACAACATGGCAAATG
CTGTTCAGAGCATGTCAAAGCAGTTGGAGCAAGTTTCATCAGCACTA
GCTGCAACAAAAAGACATCTAACTCAACGGCTTGAGAATTTGGATGG
CAAAATGGATGAACAAGTAGAGGTCTCCAAAGCTATTAGAAATGAGG
TCAATGATGTTAAAGATGACCTGTCTCAAATTGGATTTGATGTCGAAT
CAATTCAGAAAATGGTTGCTGGATTGGAGGGAAAGATCGAGTTACTT
GAGAACAAACAGGACGTGGCTAATACTGGTATCTGGTATCTCTGCCA
AGTAGCAGGCGGTTTAAAAGATGGAATAAACACCAGGTTTTTCCAGG
AAACCAGTGAGAAGCTGAAGCTCTCACATTCAGCTCAACCTGAAAAC
AAGCCAGTGAAGGGGCTTGAATTTTTTTCGGAAAGCACCATGGAACA
GAAAGTAGCTGACTCCAAACCAATTGCGGTGACAGTCGACGCTGAGA
AGCCTGAGAAAACCGCTGCTGTAATGGGCACCACAGTGCACAGGTCT
ATCAGGTTCTCATATCGGAAGGCAGGCCTTGCTTTGTGA TCAAATCCT
CTCCGCTTGAGATGCACGTGGCCTTCCTGGTTG

(Underlinded=GeneRacer Oligo sequence; Bold/Underlined=start codon; coding sequence in bold) (Sequence of 5′ RACE product CW15E10-Full_Length cloned into pCR4-TOPO) (derived from MEST15-E10, GB_ACC# BG841093).

The predicted protein or polypeptide encoded by the full-length cDNA clone of SEQ ID NO:7 has an amino acid sequence of SEQ ID NO:8, as follows:

MAMQTGVATSKVLILVGAGMTGSILLRNGRLSDVLGELQEIMKGVNQGTS
SGPYDIALIQAQIRNLAQEVRDLTLSKPITILNGKSDSGGSLSSYILPAA
AVGAMGYCYMWWKGLSLSDVMFVTKHNMANAVQSMSKQLEQVSSALAATK
RHLTQRLENLDGKMDEQVEVSKAIRNEVNDVKDDLSQIGFDVESIQKMVA
GLEGKIELLENKQDVANTGIWYLCQVAGGLKDGINTRFFQETSEKLKLSH
SAQPENKPVKGLEFFSESTMEQKVADSKPIAVTVDAEKPEKTAAVMGTTV
HRSIRFSYRKAGLAL

A putative promoter (upstream of the transcription site of the gene) for the gene of the full-length cDNA clone of SEQ ID NO:7 has a nucleotide sequence of SEQ ID NO:9, as follows:

taactctacaagctaagaatcaacatgtatgcaattccataataatcgggcatcat ctatcactcatt
gctaacttcagcactgaacatgatttcaagagtttttagcagaactactatgcggg tgatctcctttc
agatgtagatggtttagaagtgtacataagcttgcaggggcttaaggaactgttta tttaatcttctg
tgagcacgaacatccatagaagaactatctgaactgaagctaaagatttgcatgaa atggtaatttgt
acacattaagtgcatcatgcaaacagaacgagtacacagtgaaacgatacagacct cccgagtcagat
ttgccattcagtatggtaatgggctttgacaatgtcaaatctctgacttcttgcgc taaattccgaat
ctaatatcaagcacgagcatgcaaagttaagtagaaatgaataattttaccgagat ggaaagaagcaa
gagaaacttctaagcagatgctgacactgagatagtgagatgtaagatgtattcca tatgaggaagag
catacctgagcttgaataagtgcaatgtcatagggacccgaagaagttccttgatt tacacccttcat
aatctcctagaaacacaaaaggtacatcattgccttaaataaacatttactaggaa gtttcagagcat
accatcaaaatctgtatgatatgtatcaggaatcactaactagtgaagcataagtt atggtacgcaaa
acttccgagtgccaattgggcgttgatgtaattttatcacatggtgttaatcacat ccacatatagac
agaatcaacgcttctagtaccccatcgccaagtcattcaaaaaatatcaggtatca gctatctgacaa
cgctcaactatccaaaccgtatgaaagtgcgtgtaatcaaaatgaacatatttttt tcggggttgggt
gtggggggtataccgacctggagttctcccaacacatcagataagcggccattccg cagcaggatcga
gcccgtcatccctgcgaggacaccatttcaccacgtaaggtgtcgaaacaacagcc gattggggaaaa
tagcatcaaatccgagagagatttgatgggggcgagaggtcgatggcggtgatgag aagaggacctgc
accgacgaggatgaggaccttggaggtcgcgacccccgtctgcatcgccatgcctc accgctctcgcg
cttcaccggcacgcctctggatgattctagaaggggcggcgagtagaacgaggagg aggaggcggtcg
gatgtcggaagcttcaggaacaggaaggggaaagctcccgagcaaccgagcgagaa gggtgcctggac
ccgggaccgggacctgagaatttcgtgtgtcacaaacaaacagggtgaaccagttg tgaaatgggacc
acgtgtcagtgaagaggtgagtagtagtatttgtgagttgtgactcgagaaatgcc gctgcgggctgc
ggcctagccacagccacgtcagcaatgtcgaaagtcgaaaccaaccccactccacg tctcccccagga
gaagcgaccattcaaagccgccgggagctcggcgtcaccgccgcgagctcgacacc tcgacacctcgt
gccgccgcagcgcttgctttcgtcccccttacgccactcccacttggccacttcag ccaccatctccc
tgaagctagtggctaacctcctcaccgccatgggcacccctctcctcatccccctt ctcgtcaccctc
cagctgttcactacctcctcccccgcggtcgcgtcgtcacacatctccgccatcat ctcgcagtcggg
cctcgacttcgccaaggacctgctcgtatcccatgccgttgcgaccctcacgccca tgaacgtgccgg
acatcgagaggaccatgagcatacccctcgtgggcaccgtccgcatggccgcatcc gggattgtgctc
cacggcctcgccgtcaccaactccaccgtcgctgtgggggacgcgggtgttgtcgt ggccgcctcgtt
ggccagcgcgaacctcaccatggagtggaactactcgtatgacgcctggattgtga ccatatccgaca
gcgggaatgcttcggtccaggtataaatgaggggaacatatactgtgcagtcatat tagtgcaaccgt
gcaattaagcaatgatgcatcgatccaatcaaaatccaactatgattgctatttta ggtggaacatgg
ttagatgcaaaacagtcctgtttggttgatattcgatattccatcagttatgttcc ccaaggcgtggc
ttgctgattggtggctgttaattgaatcataagatactgcccgtttttttaatata ctgagtaggaga
tatacgcatcttttatgctattaagtatagactgatcgcgcgacacttgaattttg gaatatctattt
tctgtcagatgtcagaagtagaatcaattatcttagaagtgggtgctaattcacac ctattactatat
ttaaaatgggattaatataaacactctatttttctcgaaagcgcaagagagctgcg cgaaaatatatt
aagaagaagtaaaaggtccaaaaggaccccaagatacagataaggccgacctacgg cggccaataaca
agcataaatgaaaccatccatgacaaaaacactgctaccagaacagcactacatct atctagctaaca
ggtagacctgggataggggcagtaagcaaggacagcctctttgcaccagccataac ccaaagatcaat
ctccaaaccaacacttctaatagcaacagcaacactaggactcttattgtcaaaaa cgtagccattgc
gatgtttccaaagggtccaaacaccaagaatgacaagagaattaagaccatttctt gcaatcccagga
gtcttggtgatcaagtcttgccaccaatccataaaaacctcttcacaggactgatg ggccaagtgttg
tagatttacaagaagaagcagcttgaaccaaaattctctagcaaaaacgcagccca gcagcatatgat
ttaaggtttcctgatcctgatcacataatggacatctctccggatgatccatacct cttctttgcaac
ctatcagctgtccacaccttcttgtgagcgaccaaccacatgaaaaatttagattt cggaggagccca
agtcttccaaattatatgaaaaggctcaaactcaattgacccaataaagaaacccc tataagcttcct
tggaagaatattttccattggcagcaaggcgaaagaaatgcttgtcttcaacatga ggtcttagctga
accaaatctaataaatcccacaagaggagatactcgttgatacacccactgaa

(>MAGI4 20155 MAGI4.contigs_w_singleton.fas 3385 bp).

A suitable nucleic acid molecule of the present invention is a gene that is up-regulated by nitrogen and contained in a fill-length cDNA clone having the nucleotide sequence of SEQ ID NO:10, as follows:

CGACTGGAGCACGAGGACACTGACATGGACTGAAGGAGTAGAAA AACTC
CCAAATCCTTCGTTTCGTCGTCTCCACACGCAATAGCATCCGAGCAAAGA
AGCCAAAGAGCAACTGGGAGCGAGGACGGGAGGCAACAAGCGGCGGCG
GC ATG GACCGGAACCTGAGCGGGTTTCTGATCGGGTGCCTGGGCGCC
GCCGTGACGCTGCTGGCGTACCAGCAGACGGTGGTGACCAGCACGCA
GAGCGTCGCGGCGGGCTTCGTCGTCATCCTCTTCGCCCTCTTCGTCA
AGGAAGCATTCATTTCCCTCTGA ATCTCTGGTGCGCGTCAGCCAGCCAT
GCATGAGGAGGCGTCATCGCTCCGCTGCCTGTATTTCTGCTCGCTAGTTC
AGTCCCGCAGCTGCCGCTGTGCTCGTCAGGTTC

(Underlined=GeneRacer Oligo sequence; Bold/Underlined=start codon; coding sequence in bold) (Sequence of 5′ RACE product CW28B08-Full_Length cloned into pCR4-TOPO) (derived from MEST28-B08, GB_ACC# BG842208).

The predicted protein or polypeptide encoded by the full-length cDNA clone of SEQ ID NO:10 has an amino acid sequence of SEQ ID NO:11, as follows: MDRNLSGFLIGCLGAAVTLLAYQQTVVTSTQSVAAGFVVILFALFVKEGFISL.

A putative promoter (upstream of the transcription site of the gene) for the gene of the full-length cDNA clone of SEQ ID NO:10 has a nucleotide sequence of SEQ ID NO:12, as follows:

gatacgactctcgctggtatataaaatctgtttcgtagataaacatgaaaccagaa tttttgatcacc
atatacttgtttcagaagcaaattggggacaccatatacttgttgccttcaaacga ccgtacaataag
ttcagactgaccatctgaatgtcacaagagctagtttagagcagcaagaaattgtc aagtgacctaga
catcccgaaccgacgcttcccagacttagcccgaccttccgggtccttcataagct gactccgtggcc
cctcaccagaccaacgccgcagccgttgaccttgcggctttttatccccatccggc catccccaaccc
aactcccaaatccttcgtttcgtcgtctccacacgcaatagcatccgagcaaagaa gccaaagagcaa
ctgggagcgaggacgggaggcaacaagcggcggcggcatggaccggaacctgagcg ggtttctgatcg
ggtgcctgggcgccgccgtgacgctgctggcgtaccagcagacggtggtgaccagc acgcagagcgtc
gcggcgggcttcgtcgtcatcctcttcgccctcttcgtcaaggaaggattcatttc cctctgaatctc
tggtgcgcgtcagccagccatgcatgaggaggcgtcatcgctccgctgcctgtatt tctgctcgctag
ttcagtcccgcagctgccgctgtgctcgtcaggttcttggaaaaatactgtaatag cgtagtgacttt
tatgtacgacacggatggttgttgctggctgaagggtctactctgtcgaaatcgat gtatcttagttt
atgctacttgaagaacagcagactgcagatcagcagagttcttgccttcttacgct aattaataatta
ttggtacacgaatcctgattgtgttgagccttcttgccgttgctccttccctacta acatctcggctt
gccaattcacctatgtatgtttgctttgtatattagtgcaggtattaatggccgcc tgtaagtgagtt
tgttctcccttgttgaactaataaaattggcatgaattcaccccaaaaagattgat gctgtttctcac
tagttttcagcctcagacgactatagatgtccaaacagtgcggaccgtccatttga aacttgacccgt
cacgattttagtccggtccaagcatggccaagcagggttggtaacggcacgacctg tttagcgtgccg
ggtttgggcagctacagaggcccgcgtgttttggtccgatccgacacgagcaatgg gccgacacagcg
gcggcccatttttcatatggcatatggtgccagcggccacacgcccccccaaccag gccacacacccg
aaccctatctctaatcccctcaccccctcgggccctccgtccccatctctagcgat tcggcgccgtcg
ttctcgcccgttgcatcccgtcggctcttgacctcgacggcggacgactctccatc gctgtcgtatgt
ggtgctccgacctgcttggacttggagttcctccgtcctccctcgtcactccctcc gtctgcgactgg
ggactccctaaccctaacccctccggtctccggattcggtggttctagctcctcag ctgtgcaaggtt
cgtttatctcgtctaatcccctccagatttggtgtctagctgatgtctggtgctcg tctgtggtgtct
ggttgccgttgccggtggtcgtcacctgttgctcct

(>MAGI4 8905 MAGI4.contigs_w_singleton.fas 1736 bp).

A suitable nucleic acid molecule of the present invention is a gene that is up-regulated by nitrogen and contained in a fill-length cDNA clone having the nucleotide sequence of SEQ ID NO:13, as follows:

CGACTGGAGCACGAGGACACTGACATGGACTGAAGGAGTAGAAA TCTTG
GATCTGGTGGTGGGTTCATCCTTGGCCCACTTCTTCTTGAGCTTGGGTGC
ATACCGCAGGTGGCAAGTGCAACAGCAACATTCGTG ATG ATGTTCTCCT
CCTCCCTCTCTGTGGTGGAGTTTTACTTCCTGCACAGATTCCCCCTGCC
TTTTGCTGGCTACCTCATCTTCATTTCCATATTGGCTGGATTCTGGGG
CCAGTGTTTGGTTAGGAAGATCGTGCATGTGCTCAAGAGAGCATCGC
TTATTGTCTTCATCCTCTCCTCTGTTATCTTCGTCAGTGCTCTTACGAT
GGGTGTCGTTGGAACCCAGAAGAGCATTTCGATGATCAACAATCACG
AATATATGGGGTTCCTCAACTTCTGCGAGTAA CTCAAACACCATCAGAC
TGTCGATCCGTCCGGGAGAATCCAGGCCAATGCCTAATTGACCTCATCTC
CCTCAAAATCTAGAAGAATAAAGTCGCCGAGTATGTGCACAAGTTAGCTC
CTCGCCAACATGTGCGCATTTAGACCGACAGAGTCGCTGTAGTGAATTCA
GCTCGTGTTAGCTCCTGGCTAACGAGCTGACCATACGGCTTTAGTTTTGT
GAAGTGGGCGCGATTTCGTCATGTCATGCATGTGTTAGCTCCTGGCTAAC
CTGCAAATGCGTGTGTTGGTGCAGGTTTTTGTCACGTCTGCGTCAGCTCC
TGGCTGACCAGCAGTTGTTTGTCGTTCATTCTCTGCGTCAGCTCCTGGCT
GACC

(Underlined=GeneRacer Oligo sequence; Bold/Underlined=start codon; coding sequence in bold) (Sequence of 5′ RACE product CW31A10-Full_Length cloned into pCR4-TOPO) (derived from MEST31-A10, GB_ACC# BG842452).

The predicted protein or polypeptide encoded by the full-length cDNA clone of SEQ ID NO:13 has an amino acid sequence of SEQ ID NO:14, as follows:

MMFSSSLSVVEFYFLHRFPLPFAGYLIFISILAGFWGQCLVRKIVHVLKR
ASLIVFILSSVIFVSALTMGVVGTQKSISMINNHEYMGFLNFCE

A putative promoter (upstream of the transcription site of the gene) for the gene of the full-length cDNA clone of SEQ ID NO:13 has a nucleotide sequence of SEQ ID NO:15, as follows:

cttgggcggtagagctttttattagcttttcaaaaagttcaaggtcatcaaggtca gagtttaaatct
aaaagctatgcctaaaatataaaatgggtcatactgagcacccatacatatgatga tcttgtccagta
ccacatctgatacacacagagcattacggtgacccatgttccatatcttaaggtaa cgaaggtttgtc
ctaagttaaagttttgaaactttgacaacaatatctacaaaaataattatttttta cttaaagaaatt
atatattgtgctagatgttttaataataaatataatagttttatttttatttagtc aatgtttatgaa
tattttgttattaatgataaaagtttcaaaattttgacttagtataaactttcgtg atcttaagatag
ggaagagagggagtgagtaggtatcaattgcacccaggtaatgatcattttcaacg gtcaaattacta
aaaatagccgttaccaaaaactcaacagtgtacatgatgtggagcgatccgggggg agacacccactt
acgttcaatgaaaatgctagtccacgaaggagacggaagcccaccctggcctctct ttgaggcgaagc
cacgttccggccaatcgtctcacagcctctatgcaggctggaatgtcacccatgct gcacctcacctc
aaccatcgtaaatcttaaggaccattcttcttaattaactcatttgcaagggtttg tagcgccgcttt
accttagtacatgtgttacagtaaacaaacaattgccagtgctttatatgatttcg atccatcatatt
ttaggtccaaaacagcatcttcactcaaagagacagattaaagctgtttggactgc tttagctataat
aaaaatactgtagaaaaaacagaagtcggtggaagccgcagcgaacatgttctgat tttcacggaaat
acggcttgaaacgcactcggcttgcacaaacagaatgggaattgactgatatttac aatgttccatgc
aacaaatatttgcagttttgcagcctagcctggtgctagcgcaagaatgaacaaca aataactgctgg
tcagccaggagctgacgcagagaatgaacgacaaacaactgctggtcagccaggag ctgacgcagacg
tgacaaaaacctgcaccaacacacgcatttgcaggttagccaggagctaacacatg catgacatgacg
aaatcgcgcccacttcacaaaactaaagccgtatggtcagctcgttagccaggagc taacacgagctg
aattcactacagcgactctgtcggtctaaatgcgcacatgttggcgaggagctaac ttgtgcacatac
tcggcgactttattcttctagattttgagggagatgaggtcaattaggcattggcc tggattctcccg
gacggatcgacagtctgatggtgtttgagttactcgcagaagttgaggaaccccat atattcgtgatt
gttgatcatcgaaatgctcttctgggttccaacgacacctgaaactcaccgaaaca agaggccattag
gagagaagttaaaaatcaaactagattgatttagacgaaacaagtaaaagagctaa tataatgctaca
tccgttctcgaatatttgtcgtccgttagttcattttttaaaatgaactaaaacgt gacaaataaaaa
agaacggagaatggagtgagtattccttaagattatttttctcaaggatgcatgct ataattgcaaaa
tcaatttaagcaacaccggtacgtttagttcaatttaagcaacaccggtacgttta gttcaattcaac
ttggagcggtatcaggttagcaatttgccaagtttaaagctaagtagcaagtcaat gagttatcaata
ggttcatacccatcgtaagagcactgacgaagataacagaggagaggatgaagaca ataagcgatgct
ctcttgagcacatgcacgatcttcctaaccaaacactggccccagaatccagccaa tatggaaatgaa
gatgaggtagccagctgcagatagagaaacagtgcaagttattaactcgttaccat ataacaatcaca
cttatgaaaacgtctacattttgaggaattggaatctaactaatagagtaggttat ttctttagaacg
tgacatttcataa

(>MAGI4 154269 MAGI4.contigs_w_singleton.fas 2189 bp).

A suitable nucleic acid molecule of the present invention is a gene that is up-regulated by nitrogen and contained in a full-length cDNA clone having the nucleotide sequence of SEQ ID NO:16, as follows:

CGACTGGAGCACGAGGACACTGACATGGACTGAAGGAGTAGAAA AAAGT
GCTCCCGGAAGACTCCAAGCTGCAGCTACCGGCCTTCCTCTCCCCCATTC
CAATTCCGAGAACAGGGGCGGCGGAGTCAACCAGGTACG ATG TGCTCGG
TAGCGAGGCTGGCGTTTGTGCTTGCACTGGCCATAGCCGCCTCGTCAA
TTGAGGTTGCGGAGAGCAGAGATTTTAATATCTTTGCTCAGGGCAGC
TTGCCTGATGCAACCAAGGGATCGTCTGGTCTAGCTGCAACCAGTGG
AAAGTTGTGTCAGTTATGCGAGCAGTACTCATCCGAGGCGCTCCTCTA
TCTCACACAAAACGAGACCCAGACTGAGATTCTTAGCATTCTACACCA
TGAATGTGCCAGCCTTGCCCCTCTCAAACAGCAGTGCATCACGCTGG
TTGACTACTACGTACCCCTTTTCTTCTTGGAGGTCTCCATGGTTACCC
CTGAGAAGTTCTGCGAGTCGATGCATCTCTGCAAGAAGGGGATGAAG
ATTAGCCTACCCACCCGGGAGGGTACTTGTGGTTTGTGCCACCATGTT
GTTGTTGAAATTCTTATCATGCTTAAAGACCCCAACATGCAGCTGGAA
GTAATCGACCTACTCACCAAAACATGCAGCAAGGCGCAGAACTATGA
ACAGTAG TGCAAGCGGCTGGTCCTCAAGTATATTCCACTTATTCTGGTGA
AGGGCCAGAAATTCCTTGAGACAACGGATGTCTGCTCTGTGATACATGCA
TGCAAAGCAGGCACACAAGCATCAATGGAAGCCATGCCTCTGTCTGCCAT
GTTGTGAAGGTGATGCGA

(Underlined=GeneRacer Oligo sequence; Bold/Underlined=start codon; coding sequence in bold) (Sequence of 5′ RACE product CW4 2 B12-Full_Length cloned into pCR4-TOPO) (derived from MEST42-B12, GB_ACC# BG873755).

The predicted protein or polypeptide encoded by the full-length cDNA clone of SEQ ID NO:16 has an amino acid sequence of SEQ ID NO:17, as follows:

MCSVARLAFVLALAIAASSIEVAESRDFNIFAQGSLPDATKGSSGLAATS
GKLCQLCEQYSSEALLYLTQNETQTEILSILHHECASLAPLKQQCITLVD
YYVPLFFLEVSMVTPEKFCESMHLCKKGMKISLPTREGTCGLCHHVVVEI
LIMLKDPNMQLEVIDLLTKTCSKAQNYEQ

A putative promoter (upstream of the transcription site of the gene) for the gene of the full-length cDNA clone of SEQ ID NO:16 has a nucleotide sequence of SEQ ID NO:18, as follows.

gcactcatagcacatctgaggttccctttcttgaacttagctcacctactgttcat agttctgcgcct
tgctgcatgttttggtgagtaggtcgattacttccagctgcaagcttgcagcaaac aaagaaaggcat
tacagtatgtacagagtacagagcagtacaacacagaagaatgttggtgacagata gtgaaaatatgg
ttattacctgcatgttggggtctttaagcatgataagaatttcaacaacaacatgg tggcacaaacca
caagtaccctcccgggtgggtaggctaatcttcatccccttcttgcagagatgcat cgactcgcagaa
cttctcaggggtaaccatggagacctccaagaagaaaaggggtacgtagtagtcaa ccagcgtgatgc
actgcagcagggtgaatcatcaacacaacatttaacacagctgaaaacgtggtacc aatggaaggatc
acaagttacctatacctgctgtttgagaggggcaaggctggcacattcatggtgta gaatgctaagaa
tctcagtctgggtctcgttttgtgtgagatagaggagcgcctcggatgagtactgc tcgcataactga
cacaactttccactggttgcagctagaccagacgatcccttggttgcatcaggcaa gctgccctgagc
tgaattgaagacagaagaaaggattggccagaaatgcaaaacttcagaaaaacttg agttcctgtgag
gaatagcagctaagctgaagctacgccctctacattgagtagaactgatggcttag acgtaattgctt
tctttaacatgtcaccggactaaatgaagatacgaacttgtcaaacaaagaaggaa tttagataaact
aattgaaactatcacgagatctccatcgaaaagaaactatcactagacctgataat tcactgctatgg
atcaacattcaacaaagaataaagagagtaaggagcaaaaatcagtagattgaaag cttaccaaagat
attaaaatctctgctctccgcaacctcaattgacgaggcggctatggccagtgcaa gcacaaacgcca
gcctcgctaccgagcacatcgtacctgcttaccactaccagttggtcagttgacag gaacaaaactac
tgcttgaagaaaactatcgcagtgaaatcagctgtggctgatggacgcagaaaagc tggcttgctcaa
agcttctccataaagccaaaaggtaaccaaaaaaaaaagagaaaggaaatgtatcc tagggccctctc
tctacgtcatgtaacggatcagtagaagtttcagattcattcagcccgacgtaact gaagaattcagt
tcgcttcaagatgtagccatcagattcacgtatttggagtcaagccaagatagtac caattggtccgc
atccacattccaggcaacagattcacgagattcagctcgctccacgccagcagagc tgctactattct
ggcaccactccaaatacgcctttgcagcagattagcaaagcattttacgctcgctt ttgcgctttatt
ttgcccctcgtttcctttccaggtagcttccggttccgaagaatcggaggtccttg gattcagggaca
aggggtcgaactgggcagcaaatcaagaaccgaggggagacggtagtacagagagc ccaggagaagct
aacatatgaatggggaattaaagacgcatctcacctggttgactccgccgcccctg ttctcggaattg
gaatgggagagaggaaggccggtatctgcatcttggactcttccgggagcactttg ttttcttaaagc
ttcgtgttacattaagaagatgcatgagcatgtagaacagtgtgtgtggccgtgtg tgtgagaacctg
agatatttttgcttctttggtggccaagatgtgttagaaaggcataatcttttctc a

(>MAGI4 114997 MAGI4.contigs_w_singleton.fas 1961 bp)

A suitable nucleic acid molecule of the present invention is a gene that is up-regulated by nitrogen and contained in a full-length EDNA clone having the nucleotide sequence of SEQ ID NO:19, as follows:

CGACTGGAGCACGAGGACACTGACATGGACTGAAGGAGTAGAAA TATAG
CCAGAACTCTTGCATCCTGGTGATGGTAAACTGCCGTGCCAGTATAAACG
CGAAGGCAGGTCACACATACTCACAAGTCCGTCCCATCTCAGGTCATCCA
TCCATCCATCCCTGCAGCA ATG GCGTCTGCAGTGACCAGCAGCGACAA
GGAGCAGGCCGTCCCTACCATCGACGCTGACGAAGCGCACGCGCTGC
TGAGCTCCGGCCATGGCTACGTGGATGTCAGGATGCGGGGGGACTTC
CACAAGGCGCATGCGCCCGGTGCTCGGAACGTTCCCTACTACCTGTC
CGTCACGCCGCAAGGGAAGGAGAAGAACCCACACTTTGTAGAGGAAG
TGGCTGCCTTCTGTGGGAAGGATGATGTCTTCATTGTGGGTTGCAAC
ACGGGGAACAGATCCAGGTTCGCGACGGCAGACCTTCTGAACGCGGG
GTTCAAGAACGTGAGGAACCTGCAAGGTGGTTACCGCTCCTTTCAGC
AGCGAGCTCAACAGCAGTAG ACATCACGTCCTGAAGGTATGCCAGGGAT
GCTGCAGTTGAACG

(Underlined=GeneRacer Oligo sequence; Bold/Underlined=start codon; coding sequence in bold) (Sequence of 5′ RACE product CW43D12-Full_Length cloned into pCR4-TOPO) (derived from MEST43-D12, GB_ACC# BG873856).

The predicted protein or polypeptide encoded by the full-length cDNA clone of SEQ ID NO:19 has an amino acid sequence of SEQ ID NO:20, as follows:

MASAVTSSDKEQAVPTIDADEAHALLSSGHGYVDVRMRGDFHKAHAPGAR
NVPYYLSVTPQGKEKNPHFVEEVAAFCGKDDVFIVGCNTGNRSRFATADL
LNAGFKNVRNLQGGYRSFQQRAQQQ

A putative promoter (upstream of the transcription site of the gene) for the gene of the full-length cDNA clone of SEQ ID NO:19 has a nucleotide sequence of SEQ ID NO:21, as follows:

cgcactaagaaggcagggaattgtgtggcaaatataggtacatgctacacgtgtga tatttcccgatt
tgtcaatctgggacatgaagttaacatcgcaaattataatgttacaggaaccaggt atggtgctagct
tgcgtaagcaaatcaagaagatggaggtatctcagcattccaagtacttttgcgag ttctgtgggaag
gtacatttctgttagttaccctgtttctgcatccaagttttctaatctttgatcta ttgaactgcgag
ctgtctttatgttgtactcgttatcatcaccactgctgttatgaaatgtaggctgc agtcagattgat
tttgagcacatgaaatcaattagttttcgatatatctgtttgtcacaagcacatga aatcaattagtc
ttcgatatatctgtttgtcacatttgaatgatttataagatgtctgggcatgtcca tcaatgtgtttc
taagatacatttgaagacagacagcatttgttccgaatccaacctttgctgtgctg tgtttccagttt
gctgtgaagaggaaagcagttggaatttgggggtgcaaggactgtgggaaggtgaa ggctggtggtgc
ttacaccatgaagtaagtaattcttcgcctgtccgaaaaccacaatttgttagcca cggctaaattct
gttaatgtgtttgcagcactgctagtgcggtcaccgtcaggagcacgatccgccgc ctgagggagcag
actgaagcatgatatagctctttatattattggggtttcctgtagttgctcttgtc aggcatgttgtg
ggggccttatctagtggaaatgtggaatcactgtactggctgttttgccgagacaa tgctccttatat
ttggtttatgctctaggatctcaaagttgtgttaagatttgcccttggttaccgtt ctgaatctgaca
agtgatatttcatcctatgccatcttgacgtcgaatttggttgtggttttctatgc gcttggctgtgt
caatggtttgctattctgttcttgaaattctacagatactgctgcgtctctgctgg ttgagtctggtt
tagatagcaaccagtccttattattggtctttcaagttcaagtcaactaaaatgcg acaaataaaaaa
aagaatggagggagtatataactgttcaagtcaaccaatccttattacgcctgcac ttgtgtccaaaa
agaaatgccccggagctattattggtctgttgccagataagcagtgacgacgcagc atcgaaggtcag
agacgacttttttgcgagaacgagcatcaagctgacggaatggagcattattccga taaaaaaaaggt
atagccagaactcttgcatcctggtgatggtaaactgccgtgccagtataaacgcg aaggcaggtcac
acatactcacaagtccgtcccatctcaggtcatccatccatccatccctgcagcaa tggcgtctgcag
tgaccagcaggtaaacatagcttctgagtgcatctgatgttgcttacagtaacatt acatgcatagag
cagaagatcggatgcatctggattaaccagagtcagtcttgtcttggtgtgcactg cagcgacaagga
gcaggccgtccctaccatcgacgctgacgaagcgcacgcgctgctgagctccggcc atggctacgtgg
atgtcaggtgcgtagagctcagccagtcagggacgcgcctatgcgtgtgctggagc ttccagacgaac
tgacgctgacggggacgaggtggttctccttcgtgcaggatgcggggggacttcca caaggcgcatgc
gcccggtgctcggaacgttccctactacctgtccgtcacgccgcaaggtcagtttc ttgctcgctggc
gttggcgctggcactggcattggggttattgatttgagctgcctctgtccccgtgt agggaaggagaa
gaacccacactttgtagaggaagtggctgccttctgtgggaaggatgatgtcttca ttgtggtagcta
ttcactcatataaataaataaataaatgtactagtactctataaatagatagatac gcctgtaatcaa
ggagttgtcgtgtagggttgcaacacggggaacagatccaggttcgcgacggcaga ccttctgaacgc
ggtaaacacagcccatccgagctttagcatcaatccagttagctgtatgtgtgtgt gtgtgtgtgtgt
gtttaactgagggtcacactagtctgctcgcat

(>MAGI4 143540 MAGI4.contigs_w_singleton.fas 2277 bp)

A suitable nucleic acid molecule of the present invention is a gene that is up-regulated by nitrogen and contained in a full-length cDNA clone having the nucleotide sequence of SEQ ID NO:22, as follows

AAGATAGCTGCAAAACAAGCGAGTTACTTACAACCAAACAGAAGGGTAGA
AACCACCTGAAGCC ATG TGCATTGCTGCATGGATTTGGCAGGCTCACCC
TGTGCACCAACTCCTCCTGCTTCTCAACAGAGATGAGTTCCACAGCAG
GCCTACAAAAGCAGTAGGATGGTGGGGTGAAGGCTCAAAGAAGATCCT
TGGTGGCAGGGATGTGCTTGGTGGAGGAACATGGATGGGGTGCACCA
AGGATGGAAGGCTTGCCTTCCTGACCAATGTGCTTCAACCAGATGCCA
TGCCCGGTGCACGGACTAGGGGAGATCTGCCTCTCAAATTCCTGCAGA
GCAACAAGAGCCCACTCGAAGTTGCAACTGAAGTGGCAGAAGAAGCTG
ATGAATACAATGGCTTCAACCTCATACTAGCTGATCTAACAACAAATAT
CATGGTTTATGTGTCAAACCGGCCTAAGGGTCAGCCTGCAACAATTCA
ACTCGTGTCACCAGGACTCCATGTGCTGTCCAATGCAAGGCTAGATAG
CCCTTGGCAGAAGGCAATTCTCCTCGGTAAAAACTTCAGGGAGCTTCT
TAGGGAGCATGGTGCTGATGAGGTTGAAGTGAAGGATATAGTTGAGAG
GCTAATGACTGACACCACAAAGGCTGACAAAGATAGACTGCCAAACAC
TGGTTGTGATCCCAACTGGGAGCATGGTCTGAGCTCCATCTTCATTGA
GGTGCAAACTGACCAAGGGCCCTATGGGACACGGAGCACAGCCGTTTT
ATCAGTGAACTATGATGGCGAAGCTAGCTTGTACGAGAAGTATCTTGA
GAGTGGTATATGGAAGGATCACACAGTGAGTTACCAGATAGAG TAG TA
GGCATTGCACAGGAAAAGTTGGCGACCTCA

(Underlined=start and stop codons; coding sequence in bold) (Sequence of 5′ RACE product AM45C08-1T3 Full_Length cloned into pCR4-TOPO).

The predicted protein or polypeptide encoded by the full-length cDNA clone of SEQ ID NO:22 has an amino acid sequence of SEQ ID NO:23, as follows:

MCIAAWIWQAHPVHQLLLLLNRDEFHSRPTKAVGWWGEGSKKILGGRDVL
GGGTWMGCTKDGRLAFLTNVLEPDAMPGARTRGDLPLKFLQSNKSPLEVA
TEVAEEADEYNGFNLILADLTTNIMVYVSNRPKGQPATIQLVSPGLHVLS
NARLDSPWQKAILLGKNFRELLREHGADEVEVKDIVERLMTDTTKADKDR
LPNTGCDPNWEHGLSSIFIEVQTDQGPYGTRSTAVLSVNYDGEASLYEKY
LESGIWKDHTVSYQIE

(The above sequences are presented after trimming GeneRacer Oligo sequence. Cloned in pCR4-TOPO wctor at the “TOPO Cloning site”.)

A suitable nucleic acid molecule of the present invention is a gene that is up-regulated by nitrogen and contained in a full-length cDNA clone having the nucleotide sequence of SEQ ID NO:24, as follows:

CGACTGGAGCACGAGGACACTGACATGGACTGAAGGAGTAGAAA ATCAG
CCGCAGTCGCGTCGCGTCGCGTCGCGTCCAGTCCAATCCTCGGAGCCTCA
CACGGGCGGACGAGCGGGAGCTTCTCCCAATCTCCCCTGCCCTGCCCTGC
CCTGCCGCCGCGCTTAGCTTCGCATCTTCCCCTCCTCCTCCTCCTCCTTC
CTCGGCCAAGCGAGGAGCGAGGCGCGGGCGCGAGCGCGTCGTTGAG ATG
GATTCGGAGGCGGTGCAGCACGGCCTTCTCCCTCTGTCTGCCTGTCCTCC
TACCGCCAACAGCTGCGCGCATTACAGCCGTGGGTGCAGCGTCGTGG
CGCCCTGCTGCGGCCAGGCCTTCGGCTGCCGCCATTGCCACAACGAC
GCCAAGAACTCGCTGGAGGTCGACCCGCGCGACCGGCACGAGATCCC
CCGCCACGAAATAAAGAAGGTGATCTGTTCTCTCTGCTCCAAGGAAC
AGGACGTGCAACAGAACTGCTCCAGCTGTGGGGCCTGCATGGGCAAG
TACTTCTGTAAAGTATGCAAGTTCTTCGATGATGATGCCTCAAAGGGC
CAGTACCACTGTGACGGATGTGGAATATGTAGAACCGGCGGCGTGGA
GAACTTTTTCCACTGTGATAAATGTGGGTGTTGCTACAGCAATGTCTT
GAAGGATTCCCACCACTGCGTCGAAAGAGCAATGCATCACAACTGCC
CCGTCTGCTTTGAGTATCTGTTCGACTCCACGAAGGACATCAGCGTGC
TGCAATGTGGGCATACCATCCATTTGGAGTGCATGAACGAGATGAGA
GCACACCATCACTTCTCATGCCCAGTGTGCTCGAGGTCCGCCTGCGA
CATGTCGGCCACATGGCGGAAGCTCGACGAGGAGGTCGCGGCCACG
CCGATGCCTGACATCTACCAGAAGCACATGGTGTGGATCCTGTGCAA
CGACTGCAGCGCGACCTCGAGCGTGCGGTTCCACGTGCTGGGGCACA
AGTGCCCCGCGTGCAGCTCGTACAACACCCGGGAGACGAGGGCTGCG
TGCCCCAGGATCTGA GGCGAACCAGAGGCCATGTCACAAAATGCCAGGG
AGATGCCGTCCAACGACCATCTGTCTGCAGGACGTTGCTGCGCTTAAGGT
TAAAGGCTAGCGCGAGACCAGGCCTGGTAGTCCAGTCTTGAGTTTGGTGC
TGGAGCATTTGTAATGTTCCGGTAAAATGTAATGCGTCCATGAGTGCTGT
CCAGGCAGTAAGCACACCTGTGGATCGGGGCCGGCGCAAGGTCCCTAGGC
AAGCTGCAGGATTAGTGGGGCTATTCATGTTTAGGGCGCGAATGCAACGA

(Underlined=GeneRacer Oligo sequence; Bold/Underlined=start codon; coding sequence in bold) (Sequence of 5′ RACE product CW55C10-Full_Length cloned into pCR4-TOPO) (derived from MEST55-C10, GB_ACC# BM072886).

The predicted protein or polypeptide encoded by the full-length cDNA clone of SEQ ID NO:24 has an amino acid sequence of SEQ ID NO:25, as follows:

MDSEAVQHGLLPLSACPPTANSCAHYSRGCSVVAPCCGQAFGCRHCHNDA
KNSLEVDPRDRHEIPRHEIKKVICSLCSKEQDVQQNCSSCGACMGKYFCK
VCKFFDDDASKGQYHCDGCGICRTGGVENFFHCDKCGCCYSNVLKDSHHC
VERAMHHNCPVCFEYLFDSTKDISVLQCGHTIHLECMNEMRAHHHFSCPV
CSRSACDMSATWRKLDEEVAATPMPDIYQKHMVWILCNDCSATSSVRFHV
LGHKCPACSSYNTRETRAACPRI

A putative promoter (upstream of the transcription site of the gene) for the gene of the full-length cDNA clone of SEQ ID NO:24 has a nucleotide sequence of SEQ ID NO:26, as follows:

ccttacaggttatcacttaccgcctccgttttcgaatatttatcgttcgctagtta atcttaatttaa
acttaaatgaggcaaataaacgtttaaactattctcttgatcgtgtgtctgattgt cttgttgtttaa
aatgcctcctagatcgatcgtcgtagtgcaggttgttttagacaaagttgaactgc gatcagaccgag
accggacaaccattgagcagttattttcctattcatcgtggactaactggaagata ttttctgagctc
caaaaaatatccaaaggaagggagaacgtgaaggacgaggtcggaccggacacgcc tcccctcgctaa
tcattgaggcggaggcggcggaggcgattttgggaacactcgcaggtagattttgc gtgaacttggac
gagggtcattttcgctttggatgaatccacgaggtggtgtcactgcacgcgcacgg ggccctcaaacc
gtttgaaaaccaaaccgaaggcaacaaaacgagactctcatctcatctgactctac ggccagctcaag
tgatctgctgctggtggccgacctggcggcgtgatctcgctcccgtgcccgtctcc tccatccgacgc
gtacatggcccgccatcctcatccatccgccctccagaggaccagtccagaccaat aataaaagggaa
ggtcgacgacgggctcgctccaatccggcgaaccgcgtccccgtcagcctgtcatc ccgtgggcgcgc
ggctgtcgacctgcgcatcagcttctatgattagccaggagcaataatttattact cctatttgccag
gcgacgttcgtccaattcgacccggcaggcagcaggcagcagctgtgctcctgtgg gtgggtgggtca
tgggtgaccacatgcatcgatggagccagggccgccgtgtgcgcagccaactctac ctatccccgccc
ccgggatgggcgatggcaactatcctatcgcaacaatatcctggggtgggggctat aaaacggagcgg
cccgcgtggggcgcgcctccatcagccgcagtcgcgtcgcgtcgcgtcgcgtccag tccaatcctcgg
agcctcacacgggcggacgagcgggagcttctcccaatctcccctgccctgccctg ccctgccgccgc
gcttagcttcgcatcttcccctcctcctcctcctccttcctcggccaagcgaggag cgaggcgcgggc
gcgagcgcgtcgttgagatggattcggaggcggtgcagcacgggtaagcaagcaaa gcaatccatgga
tcgatccaggacacagggaggagctaggaagaggaacaatctcatgatctcattca tctgacacagcc
ttctccctctgtctgcctgtcctcctaccgccaacagctgcgcgcattacagccgt gggtgcagcgtc
gtggcgccctgctgcggccaggccttcggctgccgccattgccacaacgacgccaa ggttcggtggtt
tccctccttccgttttcgcttcggctccggttcagcagatgttctgaaacaaccct gtcccgtgcccc
ggcagaactcgctggaggtcgacccgcgcgaccggcacgagatcccccgccacgaa ataaagaaggtc
agcgttccctccctctgctcaaagagcaatctcctgcctgtttcaaccattgccta tctcgtgttcgt
ctttgttattaccgtgagcaaagaaaggaagaaacaaacaagagcgccgccttctc tcttctccttct
ccatgtaatggagcatttgttccgccgcgtagtcgagtgcaagcagcggttttcct cttttggaaacc
cacccccacgcacggttccgttccaatctcgcccttccaattgaccaacacaaacc tttcctaagatt
tcttgtcctccttacccttctacagacaagtacgaaacgcaatcgcacaaggttat actactactagc
ttttagtgttctagcgaccttagatttttttttttggttaggcatccctgattttt ctcacacttaaa
agcttcttcagataaggccatatcagctcagctcagtgctctgggagccgttctgc acttcacttgcg
tgtcactaaaaacttgactgctttccgcgatgtgctccgcaccaagtggccggcac tgcgtggtccac
aggatttttcaagagaaagccggggtcacgggtgccacttgaagccaaggacaggc gtctgggattgg
agaatatatgagaaagggataccgtcagaggcacatctcaccgtcaaactgaacag ggtctaactgct
tccagctgatttgattgagtttgagtgctgcatagttgaggacctggatatagtga cgtgtcctgaca
ggtgtctttggacctattagcagtgaatctgacgtcgatcggctaaagcaatcatg ttcgattcttat
ccttttttttttgagagtatatgcctgattcgataaacgttcctatcctgtttcct gatgatgcatat
atgttgtttcgattcatatagaatcataccatccatctattttgtttaaaaaaaaa atttctgggtgg
ccatgggcacagcatgcctgttcttaagataacgattccagtaactgttcccttct gtcactgaactc
atatgaatcgagacttaactggagctgttgcgcaggtgatctgttctctctgctcc aaggaacaggac
gtaagttgtctaccaaaacgtactcctacaacagtttttcaggagcacgcatcttt tggctgtactac
tactgctaactgcatggaaactgctcattcccatcggcaggtgcaacagaactgct ccagctgtgggg
cctgcatgggcaagtacttctgtaaagtatgcaagttcttcgatgatgatgtaagc gtactcgaatcc
cagacgatgaacaaagaaactgaactcgatgcgttgtttactgcgtttcttttttc ccccttcttctt
cacgtacatactgtactgctcttggtccaggtctcaaagggccagtaccactgtga cggatgtggaat
atgtaggtaagcaccaccacgctgatggctacgtctaaagacttgacgcgcagaag tgtaaaacttct
gtcagccgttcaaaactgataaattcgggttcctcgtcttcttgttgtttatgcag aaccggcggcgt
ggagaactttttccactgtgataaatgtggtgagtttctgcgcggacttctttctg ctaagattctgt
aaccatgctatgcagcaaagatttcactcgcgcccttattggtgtccttgttgccg tccgacagggtg
ttgctacagcaatgtcttgaaggattcccaccactgcgtcgaaagagcaatgcatc acaactgccccg
tctgctttgaggtgagagacctccgtttcaacggaacattcactctgaatgttcca atctcttgatat
tgagaaggtttccctctgttttttttcacagtatctgttcgactccacgaaggaca tcagcgtgctgc
aatgtgggcataccatccatttggagtgcatgaacgagatgagagcacaccatcag taagcatatata
ccgttctcttcggagctgagaaacggtgccacctcacaacatcctcttttagtcgc agtgaccttaca
gtctcagccctgtttggtctttggcagcttctcatgcccagtgtgctcgaggtccg cctgcgacatgt
cggccacatggcggaagctcgacgaggaggtcgcggccacgccgatgcctgacatc taccagaagcac
atggtaagaagccgaccgcccactcgttcgtcgtcccgttacatcttttccacagc catggctcgctg
tttgacgagctctgaacctgtccggggtgccgattgctggaactgaacggcaaatg aacgctgtggtg
tgagtgcaggtgtggatcctgtgcaacgactgcagcgcgacctcgagcgtgcggtt ccacgtgctggg
gcacaagtgccccgcgtgcagctcgtacaacacccgggagacgagggctgcgtgcc ccaggatctgag
gcgaaccagaggccatgtcacaaaatgccagggagatgccgtccaacgatcatctg tctgcaggacgt
tgctgcgcttaaggttaaaggctagcgcgagaccaggcctggtagtccagtcttga gtttggtgctgg
agcatttgtaatgttccggtaaaatgtaatgcgtccatgagtgctgtccaggcagt aagcacacctgt
ggatcggggccggcgcaaggtccctaggcaagctgcaggattagtggggctattca tgtttagggcgc
gaatgcaacgaaattacccgtgggccgtgggctcggtatgtaacagaaccgattat ttctattacaat
aataacatgcagttctattgggccgagcctaatcaggcaccacgaatgtgaataat tgcacatggcgc
atatatggcgggcagtagatacatataaaatggagaaaatccgtttattgccatca aaacttatactg
atcactacaataccatctaaaatgatgtgctcccttcaaaaccattggtttatatt ttctatcctttc
attgccattgccgttacataatggcgcatgtggcatatatgggcggcgtatgtagg ttcaggatggtc
acacgacatatgacgagactacagagacatggtcaagagaagttcagtggattgtg acattctgatct
aagacttcttaaaattggagttaataagatcgataatactcgtaccaataatgcac atcttgcttttt
agaagcctgttttgaaataaccccaggattaagcatgtttggcccaaagaaatttt tgtgatggtggt
cgaccgagaagttttcttgactgcatgccagtgaggacaaaaaaacacatatgaaa gaatcgtgttgg
tctgtgagaatagatcaggaagttttctcgactgcgcgaccatggatggttggggt gtttcatcaagg
atccgctttaaacacatacctttttgccttggtgatggataaggacataccggaca taaaggggataa
cccttggtgtgtgtttttttgcagacaatgtaatgctagttgatgaaagtcgggca tgagtaaatgga
aaactagagttgcggcaagaaactttataatcaaaaggttttagacttagtagaac taaaatagaata
tattggatgcgatttcagcactacatatgaggaatgagatcttagtttagaaggtc taggaaggacac
ctttagatatttagtatcagcctatagagagaccgggatattaatgaagatgctag ccataaaatcaa
agtagagtcagtgaagtggagtcaagcatctggcattttatatgacaaagtgggaa ttgcaaaagcta
aaaagaaagttttaggacaacgattagaccttctatattatatggaacataatttt agcctacaaaaa
gatgatatgtttagcagataaatgttgcggt&atacatatgttacgttggat ttgtgaacatacaaaa
agggatcgagtttagaatgatgatatacatgatagactaggggtagcaccagtcga tcgatatggttt
gaatatatccaacggagacctatagaggtgtcaatatgtcttaggacctgtttgaa agcatccagttt
ttaagaaattggtttatagaaattaaagtggttccaaacatacaagtttatgcccc agtttatataaa
ctggattatcaatttcttaaaaaccaagaagctagtctttgctagctaaaaccaac ttttgcttgttt
aattacataatgcccttgttggttgcatggaatttacatctattgtcgtcgctttt aagatagaggaa
gggtatgttagtaattgtgtatcaaaaaatagaaaatttgtttcttagaactaagt tccaaacaccct
cacccaacttttttataaactagtttctataaactggagatagaaattggttttta ataaaccggtat
gctttcaaacaataccttaggattctaagatgtgataccaatgagaaaaggaagag gaagactgaagt
tggtatgggaggtgataataaaatgagtcttgaaaaaatgagatatatctaaagat ttagccttgaat
agaaatgcatgaaaataactatccatatgtttgaaccttgactttgagttttgttg aatttttaactc
tagcctacgccaatttgtttgggactaaaaggttatgttgttgttattgccgctat aaatggtgttca
acactttcttcaagattatgatattttgttttctacaccaacaatattactgttgg ggtctccttctc
tgccgaaggtcctcaggatgaagaaactgtctttggttcatcttggtaagatacgt caaaaggaccga
atgccgaagctgtgacagacatgcagggaatatagcagagcttcgataagagttaa agcttcggctta
agatgattatgaaggtcatacaagaaaccaagccaccaatgaaaagacctgtttat ccttaaaatttg
tattagaacaatgtatagatatcagggtcataaatgtacttttgcttgggcggcgt cccgtgcctata
aatagatgaactgtacccccgtactgttgacactttcattgaaagtcattctcgca ctctctccttca
agcaagacgaaggtactaatgtaatataatgtttgtaatggttcattagaatgtta tccaaactatgt
cattaccttgatatagaaaataaagtgaattcataagataataccacattgtgata ttatctccatga
gaaatgaagatccgctcttcttcaccctcgcccaaaaaccatcatctttgagagaa gataattgaaag
gaaattgggttaaccatttcctataactaattttggtgggtgatgatcaacacaaa cccatggactaa
ctagtttgtctagaattcatggattacaggtgcataaggttcaacacaaaccaaga aagaaatccggt
tagggacacaattaaaaatggagcaaagacttga

(>MAGI4 73717 MAGI4.contigs_w_singleton.fas 7106 bp).

A suitable nucleic acid molecule of the present invention is a gene that is up-regulated by nitrogen and contained in a full-length cDNA clone having the nucleotide sequence of SEQ ID NO:27, as follows:

CGACTGGAGCACGAGGACACTGACATGGACTGAAGGAGTAGAAA GCTGC
TATTTTCTTCTTACATTGTCCACTGCGCTAGCTAGCTCGCATCTACCTGG
AAAGCTGAAAGCTAGCCAGAGCGCTAGCTAGCTTCGTTCCTCGTCGCCGC
GCGCCGGCCAG ATG ACTGCTCACCAGACTTGCTGCGATGATGCCGTTGC
CGCCGGCACTGCACCGGCTGCCAGGAGGAGGCGCCTCAAATTGACGAG
GCCGTCGGCCTCGCTCTTGATGGCGAGGAAGCTAAGGAAGAAGGCTG
CCGGCAGCAAACGCCCAAGGGCGGCAGCGTCGAGGAAGCGCGCGAT
GGCGATCAGGAGGAAGATGGAAGCGCTGAGGCTGCTCGTGCCACTCT
GCGGCCGAGACAACGGCTCGGTGACCGGTGGGGCGGTCGAACGACT
GGACGAGCTCCTCATGCACGCCGCCGGGTACATCCTGCGCCTCCAGA
TGCAGGTCAGAGTGATGCAGCTTATGGTCCATGCACTAAATGACCGG
CCCGAGGATTAA TCTTCTTCCCAAGACCATGTGATCTTCCTTCTTTAATT
TCTTCTTCATCTTCTTCGCGTGCCTGTGTTGCACGAGGCAGCTGTGCGTC
GGTGTCTGGGTGCAAATCA

(Underlined=GeneRacer Oligo sequence; Bold/Underlined=start codon; coding sequence in bold) (Sequence of 5′ RACE product CW61A10-Full_Length cloned into pCR4-TOPO) (derived from MEST61-A10, GB_ACC# BM073122).

The predicted protein or polypeptide encoded by the full-length cDNA clone of SEQ ID NO:27 has an amino acid sequence of SEQ ID NO:28, as follows:

MTAHQTCCDDAVAAGTAPAARRRRLKLTRPSASLLMARKLRKKAAGSKRP
RAAASRKRAMAIRRKMEALRLLVPLCGRDNGSVTGGAVERLDELLMHAAG
YILRLQMQVRVMQLMVHALNDRPED

A putative promoter (upstream of the transcription site of the gene) for the gene of the full-length cDNA clone of SEQ ID NO:27 has a nucleotide sequence of SEQ ID NO:29, as follows:

taaatctgacctccaaaatgtctctaatgaaagtgtctgcgagaaacagtattgct cgaccgaggaag
aaaggtatttataacacacccatcacaaatggttggcttaattaaccgcaagtgca gaatagatttgc
actgttggttcacttaataaaactgcaagtgaaaatatactttttctactatcggt tttgttaagtga
acctaccgattttgcactggtgattatttaagccaacctcatgtgataatatgaat gatttgcacgtg
gttttattaagcgaactaacaatgtaaatgtgtttccaatggtggtttttaagtcg ggaccgtcattt
tactttaactggcgcgcaccgtgctgttttatacttgactgatgaaccttcgtggt gagtggaagcgg
tgtggagcgagggctagctcatgcggccagccggcgacatttctcttgttccgatc ccccggccggcc
aaccactcaattaagtaggtgatcgattggcatgcatgcatggatgcatatcagca aatgcatatcat
atgcctcgctagctggctagtatatatagtggatgtggatcggatcatgtgacggc cgggcggtggct
gcattgcattggccctgcatatatgcacggtgacacaacaacggggcccaaataaa ggacacgtcgaa
ggtgcgcgccccagtggcgtccgacagcgcgttttgacgaggaaaagagggtgcgg gcacgcgcgcac
gcatatgctcgcggcatgcagcctcagtggccgatgacgagtggcgtgtggtgtgg ccggcggccggc
cggccgggtgcctgcgtggtgcatgttgcttgccatgcatgcgtgaaatgagccgt cagcgagcgagc
tgagggcgggcatgtggctgcatgtggccactagtttggagaacatgcggcatatg ccccggaccttc
ctgggcgctcaagcaaacaccgctctcgtgctcgctctcttgggaaatcgaagatg catgctacccaa
cgtgacctggatctcttttacgtacgcacaccctagcgtgctgctctcctgtgtcc ccgcctcctgct
agctgttcacaatatccacgcgatttaacaaacagatatgtgtgcatgctactgct tgttttcctatt
caatatagtaatctgctttatttagagtaccgtacctgtgccgtcagtgcccccaa ccccaacgtaac
tacgcacgcacatggcatctaatctatataagcatcagaccttgctcccttaatct cgcgctgctatt
ttcttattacattgtccactgcgctagctagctcgcatctacctggaaagatgaaa gctagccagagc
gctagctagcttcgttcctcgtcgccgcgcgccggccagatgactgctcaccagac ttgctgcgatga
tgccgttgccgccggcactgcaccggctgccaggaggaggcgcctcaaattgacga ggccgtcggcct
cgctcttgatggcgaggaagctaaggaagaaggctgccggcagcaaacgcccaagg gcggcagcgtcg
aggaagcgcgcgatggcgatcaggaggaagatggaagcgctgaggctgctcgtgcc actctgcggccg
agacaacggctcggtgaccggtggggcggtcgaacgactggacgagctcctcatgc acgccgccgggt
acatcctgcgcctccagatgcaggtcagagtgatgcagcttatggtccatgcacta aatgaccggccc
gaggattaatcttcttcccaagaccatgtgatcttccttctttaatttcttcttca tcttcttcgcgt
gcctgtgttgcacgaggcagctgtgcgtcggtgtctgggtgcaaatcattggctga gtgtgttattgg
tgatattatttgttcgtatatacagaatatatactcatgcatgcatactgtatgag atgatagagtaa
atctagacatatatagttcaaggaaacctacagccaacagttgtatgcatgtgagg ggggttccttgt
ctgtatgtacgcaattgtctattgtgtgacggttgaaattgaaatttcgtcaatca tcatttcttcgt
ctagataacgtgtgtacaaacggcgagtgtttaaatgaactagagctaataattag tggctaaaatta
gctggagacatccaaacaccctaactaataatttaactattagttatttttagtaa attagtcaatac
ttagctagctatttgttagctagctaattctactagcattttttagctaactagct attagctctagt
acattcaaacacccttttagggactaatttttagtctctccattttatttcatttt agtcactaaatt
accaaatacgaaaattaaagctctattttagtttccggtatttgacaatttag

(>MAGI4 145622 MAGI4.contigs_w_singleton.fas 2433 bp).

A suitable nucleic acid molecule of the present invention is a gene that is up-regulated by nitrogen and contained in a full-length cDNA clone having the nucleotide sequence of SEQ ID NO:30, as follows:

GGACACTGACATGGACTGAAGGAGTAGAAA ATCCATCCATTCCCCTCGCC
AAGCCGCCACGGCCTGACTTTCCCTCCCGCACACCCGCGACCATACAGGC
AAGTCAGGCATACACCAACAACGCTCGTCGTGCACCTCGCGCCTCAGGTC
ACCCCACCAAATTCCTCTTGATACGCCGAATTTCTTTTGCTAATTCTGCT
ACCTCCTGTCGCTAAGCCACCATATTCAGTCTAACCCCTGCTCTGAGCTC
ACCTGATTGGCGGCTCCGTTCGGCCTCTGGGCCTGGGTGTACCGACTACC
GAGGGCTCTTTCGAAATGTCAATTGGGTCGAGTTTGGTGGGCTACGTGAA
GC ATG GATGAATTTCCCGGCTGGAAGCGGGAGGCGGCAGCAGCATCCGG
GGCCGGAGCACCTGTCGCCGATGACGCCGCTCCCGCTGGCGCGGTAG
GGGTCGGTCTACTCGCTCACGTTCGACGAGTTCCAGAGCTCGCTCGG
TGGGGCCACCAAGGACTTCGGATCCATGAACATGGACGAGCTCCTCC
GCAACATCTGGTCGGCGGAGGAGACACACAGCGTCACAGCTGCGGAC
CATGCCGCGCGGGCGCCGTACGTCCAGTCCCAGGGCTCGCTCACCCT
CCCCTGCACGCTCAGCCAGAAGACCGTCGACGAGGTCTAGCGTGA CC
TCGTGTGCAACGGTGGAGGACCCTCCGACGAGGCTGTGGCGCCGCCCCAC
CGGCCCAACGGCAGCCGACGCTCGGGGAGATC ATG CTGGAGGAGTTCCT
CGTCCGCGCCGGCGTGGTGAGGGAGGACATGATGGCGGCGGCGCCC
GTACCACCAGCGCCGGGTTGCCCACCACCTCATCTGCAACCGCCAAT
GCTGTTTCCACATGGCAATGTGTTTGCTCCCTTAGTGCCTCCGCTCCA
ATTCGGGAATGGGTTTGTGTCGGGGGCTCTCAGTCAGCAGCAGGGAG
GTGTTCTTGAGGCCCCGGCGGTATCGCCGCGGCCGGTGACGGCAAGC
GGGTTCGGGAAGATGGAAGGAGACGACTTGTCGCATCTGTCGCCATC
ACCGGTGTCGTACGTTTTTTTGTGCTGGTTTGAGGGGAAGGAAGCCA
CCAGCTGTGGACAAGGTGGTTGA GAGGAGGCAACGCC

(Underlined=GeneRacer Oligo sequence; Bold/Underlined=start codon, coding sequence in bold) (Sequence of 5′ RACE product CW76H12-Full_Length cloned into pCR4-TOPO) (derived from MEST76-H12, GB_ACC# BM073865).

A predicted protein or polypeptide encoded by the full-length cDNA clone of SEQ ID NO:30 has an amino acid sequence of SEQ ID NO:31, as follows:

MDEFPGWKREAAAASGAGAPVADDAAPAGAVGVGLLAHVRRVPELARWG
HQGLRIHEHGRAPPQHLVGGGDTQRHSCGPCRAGAVRPVPGLAHPPLHAQ
PEDRRRGLA

Another predicted protein or polypeptide encoded by the full-length cDNA clone of SEQ ID NO:30 has an amino acid sequence of SEQ ID NO:32, as follows:

MLEEFLVRAGVVREDMMAAAPVPPAPGCPPPHLQPPMLFPHGNVFAPLVP
PLQFGNGFVSGALSQQQGGVLEAPAVSPRPVTASGFGKMEGDDLSHLSPS
PVSYVFLCWFEGKEATSCGQGG

A putative promoter (upstream of the transcription site of the gene) for the gene of the full-length cDNA clone of SEQ ID NO:30 has a nucleotide sequence of SEQ ID NO:33, as follows:

tagaatagccagcatcgacaaattacttacaaatagaaacattacctgtttcctcc cacgcgacctcg
cggccaactcccggttcttgatcatccggcgttgcctcctctcaaccaccttctcc acagctggtggc
ttccttcccctcaaaccagcacaaaaaaacgtacgacaccggtgatggcgacagat gcgacaagtcgt
ctccttccatcttcccgaacccgcttgccgtcaccggccgcggcgataccgccggg gcctcaagaaca
cctccctgctgctgactgagagcccccgacacaaacccattcccgaattggagcgg aggcactaaggg
agcaaacacattgccatgtggaaacagcattggcggttgcagatgaggtggtgggc aacccggcgctg
gtggtacgggcgccgccgccatcatgtcctccctcaccacgccggcgcggacgagg aactcctccagc
atgatctccccgagcgtcggctgccgttgggccggtggggcggcgccacagcctcg tcggagggtcct
ccaccgttgcacacgaggtcacgctagacctcgtcgacggtattctggctgagcgt gcaggggagggt
gagcgagccctggcactggacgtacggcgcccgcgcggcatggtccgcagctgtga cgctgtgtgtct
cctccgccgaccagatgttgcggaggagctcgtccatgttcatggatccgaagtcc ttggtggcccca
ccgagcgagctctggaactcgtcgaacgtgagcgagtagaccgacccctaccgcgc cagcgggagcgg
cgtcatcggcgacaggtgctccggccccggatgctgctgccgcctcccgcttccag ccgggaaattca
tccatgcttcacgtagcccaccaaactcgacccaattgacatttcgaaagagccct cggtagtcggta
cacccaggcccagaggccgaacggagccgccaatcaggtgagctcagagcaggggt tagactgaatat
ggtggcttagcgacaggaggtagcagaattagcaaaagaaattcggcgtatcaaga ggaatttggtgg
ggtgacctgaggcgcgaggtgcacgacgagcgttgttggtgtatgcctgacttgcc tgtatggtcgcg
ggtgtgcgggagggaaagtcaggccgtggcggcttggcgaggggaatggatggata tgtgtcgccacc
aaggagtcgtgtgggggagtttaaaacgtcgcaaggctcgaggtcgcacatggtgt tgggtttgggtg
cgtgctgggtcataaaagctgaaagggaattaggcttacacctatttcctaaatga ttttggtggttg
aattgtccaacacaaa

(>MAGI4 7232 MAGI4.contigs_w_singleton.fas 1376 bp)

A suitable nucleic acid molecule of the present invention is a gene that is up-regulated by nitrogen and contained in a full-length cDNA clone having the nucleotide sequence of SEQ ID NO:34, as follows:

ATTCCCGTCTTACCTAGCGCTAGGGTTAGTACGCGTCCACGGCGACGACC
TCTGCGCGGAGTGTGCTCCGATTGGCTGGCCTCCTCGATCCTCCTTCCCG
CGAACGCACGCGCGCGCGAGGGAGAGGTTGAGACTTGAGAGATAGACGAA
AGACGAAACAAGGGAAGGAGACGCCGTGCTCGCCTATTGGCCGCCGCCTC
CGCTCCTTCGCGCCCAATGGCTTCTGCAGCATATCAATATC ATG CAGCAT
AGCAGTACTCAGACCCTTACTACGCAGGCGTTGTTGCTCCCTATGGAAG
TCAAGATGTGTGTCCGAGGAGCCTGTCTATGTGAACGCCAAGCAGTAC
CGCGGCATTCTAAGACGGCGGCAGTCACGTGCCAAGGCCGAGCT TGA
GAGAAAGCGCTGGTCAAGCAAGAAAGCCGTATCTTCACGAGTCCCCGTCA
TCAGCACGCGATGACGAGGAGGGCGAGAGGGAACGGTGGACGCTTCCTAA
ACACGAAGAAGAGTGACCGTGTCCCTCCTGATGACTTGATACAGCTACGA
CGACACAACGAGGCTTGAAGAGGTAGCGGTCTGGCTGGCATCCTAGAGCA
GCGGTTTCTGTCCACAGGCACGTGCATCTGAGACCGGATCCGTAGCTCCA
CTCCACAGCATATGCGCAGCCCATCCATCTCGTGCACACTTG

(Underlined=start and stop codons; coding sequence in bold) (Sequence of 5′ RACE product AM77A01-5T3 Full_Length cloned into pCR4-TOPO).

The predicted protein or polypeptide encoded by the full-length cDNA clone of SEQ ID NO:34 has an amino acid sequence of SEQ ID NO:35, as follows:

MQHSSTQTLTTQALLLPMEVKMCVRGACLCERQAVPRHSKTAAVTCQGRA

(The above sequences are presented after trimming GeneRacer Oligo sequence. Cloned in pCR4-TOPO vector at the “TOPO Cloning site”.)

A suitable nucleic acid molecule of the present invention is a gene that is up-regulated by nitrogen and contained in a full-length cDNA clone having the nucleotide sequence of SEQ ID NO:36, as follows:

CGACTGGAGCACGAGGACACTGACATGGACTGAAGGAGTAGAAA AAAAA
CCCAAATCAAATTTCGCCTTCGTCGTCGTCTTATCGTCTCAGATTTGACT
CC ATG TCGGCGGCGCTCGCGGTGACGGACGAGGTGGCCCTGCCGATCC
GGGCGGTGGGGGATCTAGCGGCCGCCGCCGAGGTCTCGCGGGAGGA
GGTCGCCGTCATCACCCAGTGCGCGGCGCTCGGTGGGAAGTTGCCTT
TTGAAGATGCATCAGTTGGTGCGGTTCTTGCAGTCATTAAAAACGTGG
AAAGCTTGAGGGAGCAATTGGTTGCTGAAATCAGGCGGGTGCTGAAA
GCTGGTGGAAGAGTATTGGTGCAGAGCCCTGCACCCTCATCCAGTCA
GAAGCCGAACACTGATATTGAGCGCAAGTTACTGATGGGTGGATTTG
CTGAAGTGCAATCTTCTGCTGCAAGCTCGCAGGATAGCGTGCAATCT
GTTACAGTTAAGGCAAAGAAGGCTAGCTGGAGCATGGGCTCTTCTTT
TCCCCTTAAGAAAACAACAAAAGCCCTTCCCAAGATTCAAATTGACGA
CGACTCTGATCTGATTGATGAAGACAGTCTCTTGACTGAGGAGGACC
TGAAGAAACCACAACTTCCAGTTGTTGGGGACTGTGAGGTGGGGGCA
GCAAAGAAAGCATGCAAGAACTGTACTTGTGGCAGGGCTGAGGCCGA
GGAGAAGGTTGGGAAGCTGGAGCTCACTGCGGAGCAGATCAATAACC
CTCAGTCAGCTTGTGGCAGTTGTGGGTTGGGTGATGCCTTCCGCTGT
GGAACCTGTCCCTACAGAGGTCTTCCACCATTCAAGCCTGGCGAGAA
GGTTTCCTTGTCTGGCAACTTCCTTGCTGCTGACATATGA TGGCATCG
CCAACATCGGCAAAACAAGGA

(Underlined=GeneRacer Oligo sequence; Bold/Underlined=start codon; coding sequence in bold) (Sequence of 5′ ACE product CW88H03-Full_Length cloned into pCR4-TOPO) (Derived from MEST88-H03, GB_ACC# BM079064).

The predicted protein or polypeptide encoded by the full-length cDNA clone of SEQ ID NO:36 has an amino acid sequence of SEQ ID NO:37, as follows:

MSAALAVTDEVALPIRAVGDLAAAAEVSREEVAVITQCAALGGKLPFEDA
SVGAVLAVIKNVESLREQLVAEIRRVLKAGGRVLVQSPAPSSSQKPNTDI
ERKLLMGGFAEVQSSAASSQDSVQSVTVKAKKASWSMGSSFPLKKTTKAL
PKIQIDDDSDLIDEDSLLTEEDLKKPQLPVVGDCEVGAAKKACKNCTCGR
AEAEEKVGKLELTAEQINNPQSACGSCGLGDAFRCGTCPYRGLPPFKPGE
KVSLSGNFLAADI]

A putative promoter (upstream of the transcription site of the gene) for the gene of the full-length cDNA clone of SEQ ID NO:36 has a nucleotide sequence of SEQ ID NO:38, as follows:

gctgtaccagttgaggtactccttgacgtcctcgtacatggtgggcgccagcgggt gccagatgccgg
agtcgaggtagagcacggggtcgtcgtacttgatgccggcgcccctaagcaccggc aagtaggatccg
gcgatcatcttgaggaagttctggaggttgtccgccgagccgccgagccagaactg gaggctgaggat
gtacagccaggcgtcctgcgccttgtcggagggcaggtacttgagcaccttgggca gcgtgcgcacga
gcttgagcatgctgtcggcgaagttgctggagttggacttgctgcgcttgaagagc tggaagaagggg
ctcttggactgccccagctgcgacatgctgaaggagccgagcttgttgaggcgcat gacctcgggcat
ggaggggaagacaaggacggcgtccatgcggtcgcgctccttctcggccgcggcct tgaccttgagcg
ccagctcatcgacgaagatgagggagccgatgaagacgttgacgtcggcgaggtcg gcgaggaaggta
gcccacgacctcgaacgacgcggcgcggcgcgggtcagcgttgagctgctgcacgg cggccgtgacgg
acgactggtactgcgcctccagcacgacgtagacgaccttgacccgaggcaggccc cgcgggtcggcc
ggcaccacgcgccgcacctcgggcttggtctgcgtgaacaagccgttgccgccggc gaccgcgcaccg
gatggcgccggcgcgccgcggctgctggcgacggctgctcaggaggaacgagtgca gcggcacgggcg
ccgccaggagctgcttctgcgccgcggaggcgaatggggtggacactagcgacgac gacatggcgcct
gctcacaggacggagccggcgggcggagaaacgcgcgcctggacactgacgcgacg ctcgagcgcagt
aagtaaaaaaaaatctacactagactactagagtaaggcgcctgttcttggctcgt ggctggacaatt
gttcttggcggccgccgtccctcggaaacagagcagggaaaggagaagaagcgagc aggggagcgcgg
gaggcgggaaaatgtataggttgtccgtgtccacgtccttcgtctcaattaagaag aggcatccaggc
tcacaaaatcaatctgaaaacacatgcactgatgcacacttgtgtttgtgtagagg cgcttatatatc
atccaaaagacaagtcactcacacgcaaattcgcattggctaacagaagctatttg gaatgcagttca
gtcgactaacaacgtaggtacccccgtctccttgttttgccgatgttggcgatgcc atcatatgtcag
cagcaaggaagttgccagacaaggaaacctgccaatcggagaagcagcagcagtga acgttcaagatc
cagagtacaatcgacagacatattttgatctcctcgagaattctatcaggggagga gacgagtagaac
tgttttaccttctcgccaggcttgaatggtggaagacctctgtagggacaggttcc acagcggaaggc
atcacccaacccacactgcaaagaaaaatcaaggatcatttacagatatcaccaga cgtgataggtaa
cctagtccgagtgaacgtatgaaatttcacgagggggcacaagtgccacctgtaag caatacttacac
tgccacaagctgactgagggttattgatctgctccgcagtgagctccagcttccca accttctcctcg
gcctcagccctgccacaagtacagttcttgcatgctttctttgctgcccccacctc acagtccccaac
tggtgaaaacatcagtgaaaacatcacttaactgtttaggatccaaacctaaactg gctattgcttac
ggagttgaactaagttgacgggttttgttgctctaccaactggaagttgtggtttc ttcaggtcctcc
tcagtcaagagactgtcttcatcaatcagatcagagtcgtcgtcaatttgaatctt gggaagggcttt
tgttgttttcttaaggggaaaagaagagcccatgctccagctagccttctttgcct taacctacaagt
ggttcaaattagcacaaaaactaaagcctgcacagcaaaactaacatactataaca catgatcttaga
ccactcactgtaacagattgcacgctatcctgcgagcttgcagcagaagattgcac ttcagcaaatcc
acccatcagtaacttgcgctcaatatcagtgttcggctaacggagacaatcataaa aaaattaagaac
tttaaatcgacattgcaagagaaacgagacaacaaagacagattctgataagttaa taccttctgact
ggatgagggtgcagggctctgcaccaatactcttccaccagctttcagcacccgcc tgatttcagcaa
ccaattgctccctcaagctttccacgtttttaatgactgcaagaaccgcaccaact gatgcatcttca
aaaggcaacttcacacctgatgcatggcagaacaatagtttggtcacggttttgtg ataacacacaca
cacacacacacacacacacacacacacacacacacacacacacggcatagcactag caaagcataaca
caaattaaaaatcgaacattattgtttaatagaggctcccaaaatcaggaatgcta gcacttggctta
ttcataaacacacacatccataatcaggaagcatacattactgaaccattaaattt aataataaaaat
tcagatgttgaatccatggctgaaattttctgttccttttgaaagtataatcctaa ctttcatctccg
gctgacctggtaatatcttctagctccttttaccttatatttttttcagttgcttg agaaatagcggt
aggaaaattgacacatgtcattcgtaaatccatgggacttagagcaactccaagag cttcctaagaaa
ttgttccccaaaacatcatatagggggctgctgaaaaaaatccactaagagcaact ccaaatgagtgc
tagaaaatttccccaaaaaatgattattggggatatgttaaaaaattttaggggtg aattatcatgta
tactccaacgattccgttaaacaaatgcgactcaatctcagccacagtctgagtct tacagacacaca
caaaacctaacatgccggtggcagccacattatcacacaccggaacaaataacttt gaggcaaaaaca
cattatgcaagcagagaaacaccagaacagactcccagctgttgaagtgcaaatgt gttttctatatt
tgagttacttgctggtaaatcccgatcgggaatgtaataatcggggagttgcatta gcacttttgcag
caagctaagccaactggttgggaatgtcaagcattcttgagcaggagtactagtca agttaacaggct
tcagatcccatccaatcattgtcacatttgaatataacttgagcgggtagaaaaaa tatcataacaaa
ggcatcatggactgaatcctaaacatcataacgaaggcatcatggactgaatagcg atcatcataaca
acggcaggaaacagactcccaactgaatcatggttaacatggactgaattgtggtg gcactgcatgca
gtgcgagatgcatcatatccaggtcaattcaggttagcaaatgcaaggccacagga gttgccgccagg
gaggaggctctaggcgaggtcacgggagttgcggtggaagttgctgcggattgggg aagacctttgct
cgccaatatttgagggagagtggagctcggatgcgggacgctgataatttggggga aggaaaggggaa
ctattgggtggagaattttttgtttttcaccccaaaacatgtttttgggttggttt tagcgttcttct
ggagatgctcttaagcaactagcacatgagacatggcatagatatcaagaactgca aggagaggttca
agttcaaatctgaagaagtctgcaagggcatgtccacagattcagcggttttggag ttgggaaataac
ttcagctttcttttctttttgttgttgagacgttcttttctttttctttttttttt gttgttgttgag
gcgtcagctcgacgttttcattctacacattagaaagtggcagtagcgcaagagat accacagggcca
aaactactagtggtactgaaagttttcattcgaagaatcagtaagtggcactatca caggaagaaaca
ttgcaaggccaaacttggcgtccactgactgcgcttcaatattacttgagcaactt gctagcctcccg
atcccggaaggatggtttgataaactaattctctaattgaagtgggaacccttaag aaccaaacgtcc
actactccaaatttgattgcaaaagaaaaaagaatctagcccattccgcggaatca cgccagaaggct
cgctaattgaagcatgcaagcaaggcagcaaagagaacagcacgcatcgacgggtt cctgcatccaca
agcacgaacttggcaacttgccatggtcgcctcgagggaaagaaatagaagaaaaa atggaaagaggg
caagacgggggcgaaaccagctaagctcaccgagcgccgcgcactgggtgatgacg gcgacctcctcc
cgcgagacctcggcggcggccgctagatcccccaccgcccggatcggcagggccac ctcgtccgtcac
cgcgagcgccgccgacatggagtcaaatctgcacacgagcacacgccgagaaccag aagagactcggt
gaaaggagtatccccgaagagaaaaggaattagggttaatcgagggagggttttat ctgcacgccccc
ggattcatcacgcgactgctacctgagacgataagacgacgacgaaggcgaaattt gatttgggtttt
gcctggcctcctctcctctcgaagcttcacaacacgccgagttatttgatattgta acaatctcgtcg
cgcggcttcaccagttattactccgtagttatacttcgctagtttagtatt

(>MAGI4 101388 MAGI4.contigs_w_singleton.fas 5083 bp).

A suitable nucleic acid molecule that is modulated (e.g., up-regulated) by nitrogen is the non-symbiotic hemoglobin gene (MEST129-C09.T3Seq) from corn having the nucleotide sequence of SEQ ID NO:39, as follows:

catccatccatccatccatttccaatcccaatcccaatcccaccagtgtccagtgc tcggggaaccgac
acagctcctcagcagagtagccagcacgacaagcccgatcagcagacagcaggcat ggcactcgcggag
gccgacgacggcgcggtggtcttcggcgaggagcaggaggcgctggtgctcaagtc gtgggccgtcatg
aagaaggacgccgccaacctgggcctccgcttctttctcaaggtcttcgagatcgc gccgtcggcgaag
cagatgttctcgttcctgcgcgactccgacgtgccgctggagaagaaccccaagct caagacgcacgcc
atgtccgtcttcgtcatgacctgcgaggcggcggcgcagcttcgcaaggccgggaa ggtcaccgtgagg
gagaccacgctcaagaggctgggcgccacgcacttgaggtacggcgtcgcagatgg acacttcgaggtg
acggggttcgcgctgcttgagacgatcaaggaggcgctccccgctgacatgtggag cctcgagatgaag
aaagcctgggccgaggcctacagccagctggtggcggccatcaagcgggagatgaa gcccgatgcctag
tagtggcgattgcgaccagtgtttaacccatgacgcagcgccgtcacagatgtccc gtgtggtcttgcg
ctttagcaatttctctctggagggagcgtgtattgttatcttgtgatcgagagcct gtgtgctgccttt
gcttcttgtgattatatagctactgaataaagatgtagcgttcttcaaaaaaaaaa aaaa

The predicted protein or polypeptide encoded by the full-length cDNA clone of SEQ ID NO:39 has an amino acid sequence of SEQ ID NO:40, as follows:

MALAEADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSA
KQMFSFLRDSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRETT
LKRLGATHLRYGVADGHFEVTGFALLETIKEALPADMWSLEMKKAWAEAY
SQLVAAIKREMKPDA

A suitable nucleic acid molecule of the present invention is a gene that is up-regulated by nitrogen and contained in a full-length cDNA clone having the nucleotide sequence of SEQ ID NO:42, as follows:

T CGACTGGAGCACGAGGACACTGACATGGACTGAAGGAGTAGAAA ATCA
CCTAGCTAGAAAGGAGAGCACCGAGCGCTGCACCACTACTGCTGATATGA
GCACCTGAACCTTCTGGGCAACCACATCCGGTCCCTGCCCCTGATCATCC
GCAGCAGCC ATG GCGCAGCAGCAGGAGAAGAAGCAGCAGCAGAGGGG
GAAGCTGCAGAGGGTGCTAAGGGAGCAGAAGGCTCGGCTCTACATCA
TCCGCCGATGCGTCGTCATGCTCCTCTGCTGGAGTGAC TGA TCCATCT
CAAGCATGCATGATAAACCTGTGCTCTTTTTTTTTCCTTCTGTTTTTTCC
CCTCTTTTTCCCATCCTTTTCACCTTGCCACTTTGGTGGGCGA

(Underlined=GeneRacer Oligo sequence; Bold/Underlined=start and stop codons; coding sequence in bold) (Sequence of 5′ RACE product MEST213-C11-Full_Length cloned into pCR4-TOPO).

The predicted protein or polypeptide encoded by the full-length cDNA clone of SEQ ID NO:42 has an amino acid sequence of SEQ ID NO:43, as follows:

MAQQQEKKQQQRGKLQRVLREQKARLYIIRRCVVMLLCWSD

(The above sequence is presented after trimming. Cloned in pCR4-TOPO vector at the “TOPO Cloning site”.)

A suitable nucleic acid molecule of the present invention is a gene that is up-regulated by nitrogen and contained in a full-length cDNA clone having the nucleotide sequence of SEQ ID NO:44, as follows:

CGACTGGAGCACGAGGACACTGACATGGACTGAAGGAGTAGAAA AACTA
ACACTTCACGTGCCCCCATCCTTTTCCGCCTCAAGTCAAGTGTTCACGGT
CCATCCTCTCGAGAGTCTAGGCCCTTCTCCCGAAGCCGCAGACGCAGAAA
ACGGCTCTGCAT ATG GAGGCGAAGAAGAAGCCGTCGGCCCCCGCCGCC
GTCGGAGCCGCGCCGCCGCCGCCGGGTAACGGGTACTTCAGCACCGT
CTTCTCCGCGCCGACTGCGGGAAGCGCAAGTGACGCAAAGCATGCGG
ACTTGTACACGATGCTGAACAAGCAGAGCTCCAGAGGGCAGAATGGC
AGAGATGGCAAATCCCACAGCCGCCCTACTTACAAGGATGGCAAACA
TGCTCATCCAAATGAGCCATCAGAATCTCCTTACTTTGGCTCATCCGT
GCATTACGGTGGTCGGGAGTTCTACAGCAGCGTTTTACGGAAGCAAC
CAGCCAATGAACCCCATACGGATTACAAGGGGGACAACCCGGATGGC
TCTGCTACCAGAGGTGATTGGTGGCAAGGTTCACTTTATTACTGA ATA
ATCTGCTGGGACCTCTCCCTTTTGTGAACAAGGAATAAAAGGGGTAGAGC
TGAGAATGGTTTGTTGTAGTGTTGGAAGTGTTGACGCGAGCCGTCAAGCA
TCGATCAATAGTAATAGTTGTAATAGTTGAAAGCTGCGTCGTGACTACAA
GCATCCTGTTGGTGGAGGCAGTATTTTAGATCCATCATCACGCCTGGACA
GATGTGGGTGTCC

(Underlined=GeneRacer Oligo sequence; Bold/Underlined=start codon; coding sequence in bold) (Sequence of 5′ RACE product CW264H08-Full_Length cloned into pCR4-TOPO) (derived from MEST264-H08 GB_ACC# BM350368).

The predicted protein or polypeptide encoded by the full-length cDNA clone of SEQ ID NO:44 has an amino acid sequence of SEQ ID NO:45, as follows:

MEAKKKPSAPAAVGAAPPPPGNGYFSTVFSAPTAGSASDAKHADLYTMLN
KQSSRGQNGRDGKSHSRPTYKDGKHAHPNEPSESPYFGSSVHYGGREFYS
SVLRKQPANEPHTDYKGDNPDGSATRGDWWQGSLYY

A putative promoter (upstream of the transcription site of the gene) for the gene of the full-length cDNA clone of SEQ ID NO:44 has a nucleotide sequence of SEQ ID NO:46, as follows:

aaagcttacacttcataagagattcatagttttatcttacagccatcgttgtcaac ctcaactaccat
gcaatccgtttgggattcaactagcaagtaaggggatgtttgtttgggtttataat ctgtctggatta
tataatctaacaacttttgaactaacacttagttcaagaattgttggattatataa tctaggcagatt
ataatcccaaacaaacacttcctaagtcttgtacaggctatagagattatttttcc agaatggaggag
ggataatgacaagacctaaaagaaagttatgtttatggaaaacaaaaaaatggagc caggataatgac
acaaaagaaaggtatgttttctggaataaaaaaaattaaatatatattttgaactt cctaagactgga
acatgatacctaagctggacagatgatcaaggacagttttacccctggagacagaa aaacttataaga
cttagctttctacatcatatcctgttttgtatgtctcataattaggttccttgtat taagacgaccaa
cctatcatttgttatacaaaattcgaacgactgctgaagtctcgaagtatatagtc taggctgattaa
aatgtaagtatgggttaaagtgctgctggtaacaaactaaatacaactgtatgatg ttgttgacaaca
agacataactcaaaatgggagcaccaacaaagtgactggcaccggtgatgcaagca taacctaaacac
aactaatggaaaacgcgaattggaaactatgaaagtgtcccatatatggtatacct tgttcacaaaag
ggagaggtcccagcagattattcagtaataaagtgaacctgaaagtgaagtctagc aagtcagtgtat
gagcgtccatgtatatactgaagataatacacaaattgatgcaatgataccttgcc accaatcacctc
tggtagcagagccatccgggttgtcccccttgtactggatttaaaattcaaaataa acattagactta
agcgctccaaatgatctgtactacgtatatataaaaaggttctacgtacatccgta tggggttcattg
gctggttgcttccgtaaaacgctgctgtagaactcccgaccaccgtaatgcacgga tgagccaaagta
aggagattctgatggctcatttggatgagcatgtttgccatccttgtaagtagggc ggctgtgggatt
tgccatctgagcacgaatttaaacttccatagttaaaatcagtgctccagattaat tctaagctaaga
tggtgagaaaaggttttaagtatcgttgtgcttatgaacgcgacctaaatcgaaga gaaacgtcaaat
tgacaagagtacccagaactacctctgccattctgccctctggagctctgcttgtt cagcatcgtgta
caagtccgcatgctttgcgtcacttgcgcttcccttgaatgcaaaacaaagtcaaa atgtcaacgtca
tatccaaatagattttgcataatcctataggtcctctattatcaaaatcacccctc atcagaattaaa
ttgggaaaccgttgaagtccctccacaaatcgcaacatagtaacggactctttcat caaatcgcacca
gctcactaatcatgcaaaaaaattactaagaccccaggaatctgagagcaaaatat cagaacgatggc
gtgaagagacggcccgtaccgcagtcggcgcggagaagacggtgctgaagtacccg ttacccggcggc
ggcggcgcggctccgacggcggcgggggccgacggcttcttcttcgcctccatatg cagagccgtttt
ctgcgtctgcggcttcgggagaagggcctagactctcgagaggatggaccgtgaac acttgacttgag
gcggaaaaggatgggggcacgtgaagtgttagttgtaggcggcggcggccggcggg gaaggaagcagt
tggttgttcgcctcgtggcgtcctgcttcggccaacatctgtgccggcatttaaag gcctcgacggag
cgactcggtttcgctatttcggagatcttaaggggctgaatggagaaaattgtgtt tagctttcatcc
acatccatccaacctgcagtgagacttgcagagtgcagactcccgtattacaggga cggtcctgaata
agttagtagttttatttcagagattcaacgatgttagtatacgaattatttagaca cgtttggaatca
tccagttttttagcaatctgatttataaaaagtcaagtgcttccaaacatatcaga ttatgcttcggt
tcttaaaaatcggactgcctcttccataactaaaattagtttttaacttggtagaa attagtgattgt
aaccgctcttaggtctatgcatgtgattccctcgatgtctttatcccatttgaata tttaattattat
ttaaaaattttagattaaaaatattaattcaatctatatttaaaattggcaacaaa gaaaaacaaaga
gaataatagaatcaattacttttggaatagagtaaggattgaatttgtctttgtgt ataacaaagcta
gaagttggtttccaagaactagcctctaacacgcacacctatttttt

(>MAGI4 139395 MAGI4.contigs_w_singleton.fas 2631 bp).

The present invention relates to a nucleic acid construct having a nucleic acid molecule that is modulated by nitrogen in corn. The construct also includes a 5′ DNA promoter sequence and a 3′ terminator sequence. The nucleic acid molecule, the DNA promoter sequence, and the terminator sequence are operatively coupled to permit transcription of the nucleic acid molecule.

The nucleic acid molecules of the present invention may be inserted into any of the many available expression vectors and cell systems using reagents that are well known in the art. Suitable vectors include, but are not limited to, the following viral vectors such as lambda vector system gt11, gt WES.tB, Charon 4, and plasmid vectors such as pG-Cha, p35S-Cha, pBR322, pBR325, pACYC177, pACYC1084, pUC8, pUC9, pUC18, pUC19, pLG339, pR290, pKC37, pKC101, SV40, pBluescript II SK± or KS± (see “Stratagene Cloning Systems” Catalog (1993) from Stratagene, La Jolla, Calif., which is hereby incorporated by reference in its entirety), pQE, pIH821, pGEX, pET series (see Studier et. al., “Use of T7 RNA Polymerase to Direct Expression of Cloned Genes,” Gene Expression Technology vol. 185 (1990), which is hereby incorporated by reference in its entirety), and any derivatives thereof. Recombinant molecules can be introduced into cells via transformation, particularly transduction, conjugation, mobilization, or electroporation. The DNA sequences are cloned into the vector using standard cloning procedures in the art, as described by Sambrook et al., Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, N.Y.: Cold Spring Harbor Press (1989), and Ausubel et al., Current Protocols in Molecular Biology, New York, N.Y.; John Wiley & Sons (1989), which are hereby incorporated by reference in their entirety.

In preparing a nucleic acid vector for expression, the various nucleic acid molecule sequences may normally be inserted or substituted into a bacterial plasmid. Any convenient plasmid may be employed, which will be characterized by having a bacterial replication system, a marker which allows for selection in a bacterium, and generally one or more unique, conveniently located restriction sites. Numerous plasmids, referred to as transformation vectors, are available for plant transformation. The selection of a vector will depend on the preferred transformation technique and target species for transformation. A variety of vectors are available for stable transformation using Agrobacterium tumefaciens, a soilborne bacterium that causes crown gall. Crown gall are characterized by tumors or galls that develop on the lower stem and main roots of the infected plant. These tumors are due to the transfer and incorporation of part of the bacterium plasmid DNA into the plant chromosomal DNA. This transfer DNA (T-DNA) is expressed along with the normal genes of the plant cell. The plasmid DNA, pTi, or Ti-DNA, for “tumor inducing plasmid,” contains the vir genes necessary for movement of the T-DNA into the plant. The T-DNA carries genes that encode proteins involved in the biosynthesis of plant regulatory factors, and bacterial nutrients (opines). The T-DNA is delimited by two 25 bp imperfect direct repeat sequences called the “border sequences.” By removing the oncogene and opine genes, and replacing them with a gene of interest, it is possible to transfer foreign DNA into the plant without the formation of tumors or the multiplication of Agrobacterium tumefaciens (Fraley et al., “Expression of Bacterial Genes in Plant Cells,” Proc. Nat'l Acad. Sci. 80:4803-4807 (1983), which is hereby incorporated by reference in its entirety).

Further improvement of this technique led to the development of the binary vector system (Bevan, “Binary Agrobacterium Vectors for Plant Transformation,” Nucleic Acids Res. 12:8711-8721 (1984), which is hereby incorporated by reference in its entirety). In this system, all the T-DNA sequences (including the borders) are removed from the pTi, and a second vector containing T-DNA is introduced into Agrobacterium tumefaciens. This second vector has the advantage of being replicable in E. coli as well as A. tumefaciens, and contains a multiclonal site that facilitates the cloning of a transgene. An example of a commonly-used vector is pBin19 (Frisch et al., “Complete Sequence of the Binary Vector Bin 19, ” Plant Molec. Biol 27:405-409 (1995), which is hereby incorporated by reference in its entirety). Any appropriate vectors now known or later described for genetic transformation are suitable for use with the present invention.

U.S. Pat. No. 4,237,224 to Cohen and Boyer, which is hereby incorporated by reference in its entirety, describes the production of expression systems in the form of recombinant plasmids using restriction enzyme cleavage and ligation with DNA ligase. These recombinant plasmids are then introduced by means of transformation and replicated in unicellular cultures including prokaryotic organisms and eukaryotic cells grown in tissue culture.

Certain “control elements” or “regulatory sequences” are also incorporated into the vector-construct. These include non-translated regions of the vector, promoters, and 5′ and 3′ untranslated regions which interact with host cellular proteins to carry out transcription and translation. Such elements may vary in their strength and specificity. Depending on the vector system and host utilized, any number of suitable transcription and translation elements, including constitutive and inducible promoters, may be used. Tissue-specific and organ-specific promoters can also be used.

A constitutive promoter is a promoter that directs expression of a gene throughout the development and life of an organism. Examples of some constitutive promoters that are widely used for inducing expression of transgenes include the nopaline synthase (“NOS”) gene promoter from Agrobacterium tumefaciens (U.S. Pat. No. 5,034,322 to Rogers et al., which is hereby incorporated by reference in its entirety), the cauliflower mosaic virus (“CaMY”) 35S and 19S promoters (U.S. Pat. No. 5,352,605 to Fraley et al., which is hereby incorporated by reference in its entirety), those derived from any of the several actin genes, which are known to be expressed in most cells types (U.S. Pat. No. 6,002,068 to Privalle et al., which is hereby incorporated by reference in its entirety), and the ubiquitin promoter, which is a gene product known to accumulate in many cell types.

An inducible promoter is a promoter that is capable of directly or indirectly activating transcription of one or more DNA sequences or genes in response to an inducer. In the absence of an inducer, the DNA sequences or genes will not be transcribed. The inducer can be a nutrient (e.g., nitrogen, including nitrogen in the form of nitrate), a chemical agent, such as a metabolite, growth regulator, herbicide, or phenolic compound, or a physiological stress directly imposed upon the plant such as cold, heat, salt, toxins, or through the action of a pathogen or disease agent such as a virus or fungus. A plant cell containing an inducible promoter may be exposed to an inducer by externally applying the inducer to the cell or plant such as by spraying, watering, heating, or by exposure to the operative pathogen. An example of an appropriate inducible promoter is a glucocorticoid-inducible promoter (Schena et al., “A Steroid-Inducible Gene Expression System for Plant Cells,” Proc. Natl. Acad. Sci. 88:10421-5 (1991), which is hereby incorporated by reference in its entirety). Expression of the transgene-encoded protein is induced in the transformed plants when the transgenic plants are brought into contact with nanomolar concentrations of a glucocorticoid, or by contact with dexamethasone, a glucocorticoid analog (see Schena et al., “A Steroid-Inducible Gene Expression System for Plant Cells,” Proc. Natl. Acad. Sci. USA 88:10421-5 (1991); Aoyama et al., “A Glucocorticoid-Mediated Transcriptional Induction System in Transgenic Plants,” Plant J. 11:605-612 (1997); and McNellis et al., “Glucocorticoid-Inducible Expression of a Bacterial Avirulence Gene in Transgenic Arabidopsis Induces Hypersensitive Cell Death, Plant J. 14(2):247-57 (1998), which are hereby incorporated by reference in their entirety). In addition, inducible promoters include promoters that function in a tissue specific manner to regulate the gene of interest within selected tissues of the plant. Examples of such tissue specific or developmentally regulated promoters include seed, flower, fruit, or root specific promoters as are well known in the field (U.S. Pat. No. 5,750,385 to Shewmaker et al., which is hereby incorporated by reference in its entirety).

A number of tissue- and organ-specific promoters have been developed for use in genetic engineering of plants (Potenza et al., “Targeting Transgene Expression in Research, Agricultural, and Environmental Applications: Promoters used in Plant Transformation,” In Vitro Cell. Dev. Biol. Plant 40:1-22 (2004), which is hereby incorporated by reference in its entirety). Examples of such promoters include those that are floral-specific (Annadana et al., “Cloning of the Chrysanthemum UEP1 Promoter and Comparative Expression in Florets and Leaves of Dendranthema grandiflora,” Transgenic Res. 11:437-445(2002), which is hereby incorporated by reference in its entirety), seed-specific (Kluth et al., “5′ Deletion of a gbss1 Promoter Region Leads to Changes in Tissue and Developmental Specificities,” Plant Mol. Biol. 49:669-682 (2002), which is hereby incorporated by reference in its entirety), root-specific (Yamamoto et al., “Characterization of cis-acting Sequences Regulating Root-Specific Gene Expression in Tobacco,” Plant Cell 3:371-382 (1991), which is hereby incorporated by reference in its entirety), fruit-specific (Fraser et al., “Evaluation of Transgenic Tomato Plants Expressing an Additional Phytoene Synthase in a Fruit-Specific Manner,” Proc. Natl Acad. Sci. USA 99:1092-1097 (2002), which is hereby incorporated by reference in its entirety), and tuber/storage organ-specific (Visser et al., “Expression of a Chimaeric Granule-Bound Starch Synthase-GUS gene in transgenic Potato Plants,” Plant Mol Biol. 17:691-699 (1991), which is hereby incorporated by reference in its entirety). Targeted expression of an introduced gene (transgene) is necessary when expression of the transgene could have detrimental effects if expressed throughout the plant. On the other hand, silencing a gene throughout a plant could also have negative effects. However, this problem could be avoided by localizing the silencing to a region by a tissue-specific promoter.

A suitable promoter can also be one that is gene-specific, in that it regulates transcription of a nucleic acid molecule of the present invention. A suitable gene-specific promoter gene-specific promoter (derived from MAGI93503) has a nucleotide sequence of SEQ ID NO:41 as follows:

CGTTGTCGGAACGTCCCGTCGATGTTCGGAAACGAGCACGACCCGTCGACTCCTGC TTCTTGGCGGAGA
AGAAAGGGGACGACGAGCGAGCGTTTTGACTTTGATTTCCTCGCTAAAACCGGCCG CTGTTTTTGCTTT
CCGCGCGAGCCGCCCACGTTATTGACTGACGCTGGTGCGAGAGCGCTGCTGCCTCT GCGGTTGCCGTCT
GCGCTCCAGTGGTAGCCGAGAATATTGTTAGGTCCGTAGGATCAGATTTGCTACGT ACTAAAAAAATTC
CTTAAACTTTAATTGTGTATTTTTTTTAAAAAAAATTATAGCATTTATCAGCAACA AAACTCTAAAAAC
ATGTTTAGTTCGCTGCTTAATTTATCACATATTGTCTAAATTTTATATATAAATTA TTTAATTCGAACG
ACTAACCAGAACCCAGACCTACAATAAATTTGCCCCCGCTGCTGCGCTCCCCAGCT CCCCAAGTCCCTA
ACCCGCCCTCGCTTTGTCGCCGCGGCACACGGTTTTGGCCGTGGACAGGACAGTTG CACCCTAGCCCCA
TTGGCCGATTCCGAGCTAGGAAGGAGTATATGCGTATCGGTAGTAACCGAGGAGCA ACGCAACATGTCC
ACAGCCCGCGCGCTGGTAACGGGTCCATGCGTCTTGGCTCATCAGGTGCCCCAAGG GACGCCCTCGCCC
GGTCTGACCCACCTATATAAACTTAAAACTTGTGCCCCAACATCATCAGTTCGTAT CACACCCAACCTC
CCACTGTAAAAAAGAGCAGCGGAACGTGCGTGCATCCATCCATCCATCCATTTCCA ATCCCAATCCCAA
TCCCACCAGTGTCCAGTGCTCGGGGAACCGACACAGCTCCTCAGCAGAGTAGCCAG CACGACAAGCCCG
ATCAGCAGACAGCAGGCATG

This gene-specific promoter is a fragment of genomic DNA of maize that is likely to include promoter elements that allow the gene of SEQ ID NO:39 to exhibit nitrogen-regulated expression. Other suitable promoters include those having a nucleotide sequence of SEQ ID NO:3, SEQ ID NO:6, SEQ ID NO:9, SEQ ID NO:12, SEQ ID NO:15, SEQ ID NO:18, SEQ ID NO:21, SEQ ID NO:26, SEQ ID NO:29, SEQ ID NO:33, SEQ ID NO:38, SEQ ID NO:41, and/or SEQ ID NO:46.

The nucleic acid construct of the present invention also includes an operable 3′ regulatory region, selected from among those which are capable of providing correct transcription termination and polyadenylation of mRNA for expression in the host cell of choice, operably linked to a modified trait nucleic acid molecule of the present invention. A number of 3′ regulatory regions are known to be operable in plants. Exemplary 3′ regulatory regions include, without limitation, the nopaline synthase (NOS) 3′ regulatory region (Fraley et al., “Expression of Bacterial Genes in Plant Cells,” Proc. Nat'l Acad. Sci. USA 80:4803-4807 (1983), which is hereby incorporated by reference in its entirety) and the cauliflower mosaic virus (CaMV) 3′ regulatory region (Odell et al., “Identification of DNA Sequences Required for Activity of the Cauliflower Mosaic Virus 35 S Promoter,” Nature 313(6005):810-812 (1985), which is hereby incorporated by reference in its entirety). Virtually any 3′ regulatory region known to be operable in plants would be suitable for use in conjunction with the present invention.

The different components described above can be ligated together to produce expression systems which contain the nucleic acid constructs of the present invention, using well known molecular cloning techniques as described in Sambrook et al., Molecular Cloning: A Laboratory Manual, Second Edition Cold Spring Harbor, N.Y.: Cold Spring Harbor Press (1989), and Ausubel et al. Current Protocols in Molecular Biology, New York, N.Y.: John Wiley & Sons (1989), which are hereby incorporated by reference in their entirety.

Once the nucleic acid construct of the present invention has been prepared, it is ready to be incorporated into a host cell. Accordingly, another aspect of the present invention relates to a recombinant host cell containing one or more of the nucleic acid constructs of the present invention. Basically, this method is carried out by transforming a host cell with a nucleic acid construct of the present invention under conditions effective to achieve transcription of the nucleic acid molecule in the host cell. This is achieved with standard cloning procedures known in the art, such as described by Sambrook et al., Molecular Cloning: A Laboratory Manual, Second Edition, Cold Springs Laboratory, Cold Springs Harbor, N.Y. (1989), which is hereby incorporated by reference in its entirety. Suitable hosts include, but are not limited to, bacterial cells, viruses, yeast cells, mammalian cells, insect cells, plant cells, and the like. Preferably the host is either a bacterial cell or a plant cell. Methods of transformation may result in transient or stable expression of the nucleic acid under control of the promoter. Preferably, a nucleic acid construct of the present invention is stably inserted into the genome of the recombinant plant cell as a result of the transformation, although transient expression can serve an important purpose, particularly when the plant under investigation is slow-growing.

Plant tissue suitable for transformation includes leaf tissue, root tissue, meristems, zygotic and somatic embryos, callus, protoplasts, tassels, pollen, embryos, anthers, and the like. The means of transformation chosen is that most suited to the tissue to be transformed.

Transient expression in plant tissue can be achieved by particle bombardment (Klein et al., “High-Velocity Microprojectiles for Delivering Nucleic Acids Into Living Cells,” Nature 327:70-73 (1987), which is hereby incorporated by reference in its entirety), also known as biolistic transformation of the host cell, as disclosed in U.S. Pat. Nos. 4,945,050, 5,036,006, and 5,100,792, all to Sanford et al., and in Emerschad et al., “Somatic Embryogenesis and Plant Development from Immature Zygotic Embryos of Seedless Grapes ( Vitis vinifera ),” Plant Cell Reports 14:6-12 (1995), which are hereby incorporated by reference in their entirety.

In particle bombardment, tungsten or gold microparticles (1 to 2 μm in diameter) are coated with the DNA of interest and then bombarded at the tissue using high pressure gas. In this way, it is possible to deliver foreign DNA into the nucleus and obtain a temporal expression of the gene under the current conditions of the tissue. Biologically active particles (e.g., dried bacterial cells containing the vector and heterologous DNA) can also be propelled into plant cells. Other variations of particle bombardment, now known or hereafter developed, can also be used. Further, particle bombardment transformation can be used to stably introduce the nucleic acid construct into plant cells.

Another appropriate method of stably introducing the nucleic acid construct into plant cells is to infect a plant cell with Agrobacterium tumefaciens or Agrobacterium rhizogenes previously transformed with the nucleic acid construct. As described above, the Ti (or RI) plasmid of Agrobacterium enables the highly successful transfer of a foreign nucleic acid molecule into plant cells. A variation of Agrobacterium transformation uses vacuum infiltration in which whole plants are used (Senior, “Uses of Plant Gene Silencing,” Biotechnology and Genetic Engineering Reviews 15:79-119 (1998), which is hereby incorporated by reference in its entirety).

Yet another method of introduction is fusion of protoplasts with other entities, either minicells, cells, lysosomes, or other fusible lipid-surfaced bodies (Fraley et al., Proc. Natl. Acad. Sci. USA 79:1859-63 (1982), which is hereby incorporated by reference in its entirety). The nucleic acid molecule may also be introduced into the plant cells by electroporation (Fromm et al., Proc. Natl Acad. Sci. USA 82:5824 (1985), which is hereby incorporated by reference in its entirety). In this technique, plant protoplasts are electroporated in the presence of plasmids containing the expression cassette. Electrical impulses of high field strength reversibly permeabilize biomembranes allowing the introduction of the plasmids. Electroporated plant protoplasts reform the cell wall, divide, and regenerate. Other methods of transformation include polyethylene-mediated plant transformation, micro-injection, physical abrasives, and laser beams (Senior, “Uses of Plant Gene Silencing,” Biotechnology and Genetic Engineering Reviews 15:79-119 (1998), which is hereby incorporated by reference in its entirety). The precise method of transformation is not critical to the practice of the present invention. Any method that results in efficient transformation of the host cell of choice is appropriate for practicing the present invention. Transfromation can also be achieved using the “whisker” method, as is well known in the art.

After transformation, the transformed plant cells must be regenerated. Plant regeneration from cultured protoplasts is described in Evans et al., Handbook of Plant Cell Cultures, Vol 1, New York, N.Y.: MacMillan Publishing Co. (1983); Vasil, ed., Cell Culture and Somatic Cell Genetics of Plants, Vol. I (1984) and Vol. III (1986), Orlando: Acad. Press, which are hereby incorporated by reference in their entirety.

Means for regeneration vary from species to species of plants, but generally a suspension of transformed protoplasts or a petri plate containing explants is first provided. Callus tissue is formed and shoots may be induced from callus and subsequently rooted. Alternatively, embryo formation can be induced in the callus tissue. These embryos germinate as natural embryos to form plants. The culture media will generally contain various amino acids and hormones, such as auxin and cytokinins. Efficient regeneration will depend on the medium, on the genotype, and on the history of the culture. If these three variables are controlled, then regeneration is usually reproducible and repeatable.

Preferably, transformed cells are first identified using a selection marker simultaneously introduced into the host cells along with the nucleic acid construct of the present invention. Suitable selection markers include, without limitation, markers encoding for antibiotic resistance, such as the neomycin phosphotransferae II (“nptII”) gene which confers kanamycin resistance (Fraley et al., Proc. Natl. Acad. Sci. USA 80:4803-4807 (1983), which is hereby incorporated by reference in its entirety), and the genes which confer resistance to gentamycin, G418, hygromycin, streptomycin, spectinomycin, tetracycline, chloramphenicol, and the like. Cells or tissues are grown on a selection medium containing the appropriate antibiotic, whereby generally only those transformants expressing the antibiotic resistance marker continue to grow. Other types of markers are also suitable for inclusion in the expression cassette of the present invention. For example, a gene encoding for herbicide tolerance, such as tolerance to sulfonylurea is useful, or the dhfr gene, which confers resistance to methotrexate (Bourouis et al., EMBO J. 2:1099-1104 (1983), which is hereby incorporated by reference in its entirety). Similarly, “reporter genes,” which encode for enzymes providing for production of an identifiable compound are suitable. The most widely used reporter gene for gene fusion experiments has been uidA, a gene from Escherichia coli that encodes the β-glucuronidase protein, also known as GUS (Jefferson et al., “GUS Fusions: β Glucuronidase as a Sensitive and Versatile Gene Fusion Marker in Higher Plants,” EMBO J 6:3901-3907 (1987), which is hereby incorporated by reference in its entirety). Similarly, enzymes providing for production of a compound identifiable by luminescence, such as luciferase, are useful. The selection marker employed will depend on the target species; for certain target species, different antibiotics, herbicide, or biosynthesis selection markers are preferred.

Plant cells and tissues selected by means of an inhibitory agent or other selection marker are then tested for the acquisition of the transgene (Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor, N.Y.: Cold Spring Harbor Press (1989), which is hereby incorporated by reference in its entirety).

After the fusion gene containing a nucleic acid construct of the present invention is stably incorporated in transgenic plants, the transgene can be transferred to other plants by sexual crossing. Any of a number of standard breeding techniques 10 can be used, depending upon the species to be crossed. Once transgenic plants of this type are produced, the plants themselves can be cultivated in accordance with conventional procedure so that the nucleic acid construct is present in the resulting plants. Alternatively, transgenic seeds are recovered from the transgenic plants. These seeds can then be planted in the soil and cultivated using conventional procedures to produce transgenic plants. The component parts and fruit of such plants are encompassed by the present invention.

The present invention can be utilized in conjunction with a wide variety of plants or their seeds. Suitable plants can include dicots and monocots. More particular, suitable plants can include the following: rice, corn, soybean, canola, potato, wheat, mung bean, alfalfa, barley, rye, cotton, sunflower, peanut, sweet potato, bean, pea, chicory, lettuce, endive, cabbage, brussel sprout, beet, parsnip, turnip, cauliflower, broccoli, radish, spinach, onion, garlic, eggplant, pepper, celery, carrot, squash, pumpkin, zucchini, cucumber, apple, pear, melon, citrus, strawberry, grape, raspberry, pineapple, tobacco, tomato, sorghum, sugarcane, banana, Arabidopsis thaliana, Saintpaulia, petunia, pelargonium, poinsettia, chrysanthemum, carnation, crocus, marigold, daffodil, pine, Medicago truncatula, Sandersonlia aurantiaca, and zinnia.

Another aspect of the present invention is a method of expressing a nucleic acid molecule that is modulated by nitrogen in a plant. This method involves providing a transgenic plant or plant seed transformed with a nucleic acid construct having a nucleic acid molecule that is modulated by nitrogen in corn, a 5′ DNA promoter sequence, and a 3′ terminator sequence. The nucleic acid molecule, the DNA promoter sequence, and the terminator sequence are operatively coupled to permit transcription of the nucleic acid molecule. The method also involves growing the transgenic plant or a transgenic plant grown from the transgenic plant seed under conditions effective to express the nucleic acid molecule in the transgenic plant or the plant grown from the transgenic plant seed. In one embodiment, the transgenic plant or plant seed is provided by transforming a non-transgenic plant or a non-transgenic plant seed with the nucleic acid construct of the present invention to yield said transgenic plant or plant seed. In one aspect, the growing step is effective in reducing nitrogen uptake of the transgenic plant or the plant grown from the transgenic plant seed. In another aspect, the growing step is effective in increasing nitrogen uptake of the transgenic plant or the plant grown from the transgenic plant seed. In yet another aspect, the growing step is effective in increasing efficiency of nitrogen utilization of the transgenic plant or the plant grown from the transgenic plant seed. Transformation of the transgenic plant or plant seed can be achieved using Agrobacterium -mediated transformation, the whisker method, vacuum infiltration, biolistic transformation, electroporation, micro-injection, polyethylene-mediated transformation, or laser-beam transformation.

The present invention also relates to an isolated DNA promoter from corn suitable for inducing nitrogen-regulated expression of a protein encoded by an isolated DNA molecule operably associated with the DNA promoter. A suitable DNA promoter for use in this method can be any one of the promoters described herein, including, for example, the promoters having a nucleotide sequence of SEQ ID NO:3, SEQ ID NO:6, SEQ ID NO:9, SEQ ID NO:12, SEQ ID NO:15, SEQ ID NO:18, SEQ ID NO:21, SEQ ID NO:26, SEQ ID NO:29, SEQ ID NO:33, SEQ ID NO:38, SEQ ID NO:41, and/or SEQ ID NO:46. The isolated DNA promoter can be used to prepare nucleic acid constructs as previously described. In a particular nucleic acid construct, the isolated DNA promoter can be operably linked to an isolated nucleic acid that either has a nucleotide sequence (or encoding portion thereof) of SEQ ID NO:1, SEQ ID NO:4, SEQ ID NO:7, SEQ ID NO:10, SEQ ID NO:13, SEQ ID NO:16, SEQ ID NO:19, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:27, SEQ ID NO:30, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:39, SEQ ID NO:42, and/or SEQ ID NO:44, or encodes a polypeptide having an amino acid sequence of SEQ ID NO:2, SEQ ID NO:5, SEQ ID NO:8, SEQ ID NO:11, SEQ ID NO:14, SEQ ID NO:17, SEQ ID NO:20, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:28, SEQ ID NO:31, SEQ ID NO:32, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:40, SEQ ID NO:43, and/or SEQ ID NO:45. Other suitable genes from corn that can be regulated by the DNA promoter of the present invention include, for example, nitrate reductase, nitrite reductase, Uroporphyrin-III methyl transferase. Expression vectors can be prepared by inserting the nucleic acid construct in an appropriate vector (as described in more detail supra), and transgenic host cells and plants (including their component parts such as fruits and seeds) can be produced by transforming them with the nucleic acid construct containing the DNA promoter.

The present invention also relates to a method of directing nitrogen-regulated expression of an isolated nucleic acid in plants. This methods involves transforming a plant cell with the nucleic acid construct that includes an isolated DNA promoter suitable for inducing nitrogenregulated expression of a protein encoded by an isolated DNA molecule operably associated with the DNA promoter. This method also involves regenerating a plant from the transformed plant cell. By this method, expression of the nucleic acid molecule, under control of the DNA promoter, occurs in the plant and is upregulated by nitrogen. A suitable DNA promoter for use in this method can be any one of the promoters described herein, including, for example, the promoters having a nucleotide sequence of SEQ ID NO:3, SEQ ID NO:6, SEQ ID NO:9, SEQ ID NO:12, SEQ ID NO:15, SEQ ID NO:18, SEQ ID NO:21, SEQ ID NO:26, SEQ ID NO:29, SEQ ID NO:33, SEQ ID NO:38, SEQ ID NO:41, and/or SEQ ID NO:46.

Although preferred embodiments have been depicted and described in detail herein, it will be apparent to those skilled in the relevant art that various modifications, additions, substitutions, and the like can be made without departing from the spirit of the invention and these are, therefore, considered to be within the scope of the invention as defined in the claims which follow.