Patents and Patent Applications from Temple University

Match Document Document Title
5444156 Monoclonal antibodies to human plasma prekallikrein  
Four novel cell lines, ATCC #HB-8862 through ATCC #HB-8865 produce monoclonal antibody to human plasma prekallikrein. At least three of the antibodies also recognize plasma kallikrein,...
5444052 Amphotericin B composition with enhanced fungal activity  
Fungal infections are treated by administering a combination of (a) amphotericin B, and (b) a glycerol ether selected from the group consisting of (i) HOCH2 CHOHCH2 OR, (ii) HOCH2 CH(OR1)CH2 OH,...
5437864 Method of inhibiting blood coagulation in extracorporeal circulation by inhibiting human tissue factor  
This invention provides a method of inhibiting coagulation in extracorporeal circulation in a subject, comprising administration of a therapeutically effective amount of a monoclonal antibody...
5429123 Process control and apparatus for ventilation procedures with helium and oxygen mixtures  
A process is provided for controlling a ventilation procedure wherein a heliox ventilation system passes a breathing medium through at least a portion of a patient's pulmonary pathways. In this...
5427916 Method for predicting the effectiveness of antineoplastic therapy in individual patients  
The effectiveness of selected antineoplastic agents may be determined in individual patients by comparing the level of expression of one or more selected growth-regulated genes in neoplastic cells...
5412979 Method and apparatus for dissolution testing of a dosage form  
An apparatus and method determines the dissolution of a drug from a dosage form, most particularly a swellable dosage form. An inert, transparent cylindrical vessel having a hemispherical bottom...
5405939 2',5'-phosphorothioate oligoadenylates and their covalent conjugates with polylysine  
Optically active compounds of the formula ##STR1## wherein n is 1 or 2 and m is 0, 1, 2 or 3 have antiviral activity. Compounds of the formula wherein at least one of the internucleotide...
5401506 Stabilized insect nematode compositions  
An insecticidal composition comprising a first composition having an effective amount of at least one species of entomopathogen distributed in a matrix. A second composition selected from...
5381534 System for automatically generating efficient application - customized client/server operating environment for heterogeneous network computers and operating systems  
A high level virtual computer in a heterogeneous hardware and software environment. A user specifies the hardware and software configuration of a virtual computer employing multiple coarse grain...
5380646 Thrombus detection using radiolabelled disintegrins  
Radiolabelled polypeptides derived from the Viperidae disintegrins are provided as well as a method for the detection of venous and arterial thrombi, pulmonary emboli and tumors or abscesses that...
5350359 Control, treatment and/or diagnosis of physiological conditions with degassed perfluorocarbon liquid  
This invention pertains to the use of a degassed perfluorocarbon ("PFC") liquid as a method of removing gas emboli from parts of a patient's internal anatomy. Moreover, the invention can be used...
5347028 Highly functionalized polycyclosiloxanes and their polymerization into thermally reversible living rubbers  
A composition curable to a thermally reversible rubber comprises (i) a strong acid catalyst having a pKa of less than about -9, (ii) at least one polycyclosiloxane containing at least one...
5336667 Method for inhibiting the ahesion of platelet with alboaggregins: platelet agonists which bind to platelet membrane glycoprotein IB  
A family of proteins are provided which may be purified from snake venom. Each protein binds to the 45 kDa N-terminal domain of human platelet glycoprotein Ib, thereby inhibiting the binding of...
5335650 Process control for liquid ventilation and related procedures  
A process is provided for controlling a ventilation procedure wherein a liquid ventilation system passes a breathing liquid through at least a portion of a patient's pulmonary pathways. In this...
5330836 Functionalized silica particle and use thereof for cross-linking silicones  
Particulate fillers containing Si-OH groups are functionalized by treatment with a silica bonding agent. The treated particles are effectively polyfunctional, and may be used to prepare highly...
5298589 Highly functionalized polycyclosiloxanes and their polymerization into thermally reversible living rubbers  
A composition curable to a thermally reversible rubber comprises (i) a strong acid catalyst having a pKa of less than about -9, (ii) at least one polycyclosiloxane containing at least one...
5288490 Thrombus-targeted complexes of plasminogen activator and fibrin fragments  
Thrombolytic hybrids are formed as covalent or non-covalent complexes of fibrin fragments and plasminogen activator molecules. Native plasmin degradation fragments of fibrin or non-native fibrin...
5285794 Respiratory gas monitor  
A method and apparatus for monitoring the respiratory gas of a patient includes an adjustable volume gas mixing chamber which allows for the differences in lung capacity of patients from neonate...
5284663 Salt film encapsulated perfluorocarbons  
An artificial blood substitute comprising Lewis acid--Lewis base salt film microcapsule having a perfluorocarbon encapsulated therein. The Lewis base may be a polyoxyalkylene adduct of an amine...
5254654 Monodispersed polydimethylsiloxane-α,ω-diol fluids and α,ω-substituted polydimethylsiloxanes and polydimethylcyclosiloxanes prepared therefrom  
The molecular weight distribution of polydimethylsiloxane-α, ω-diol fluids is reduced by contacting the fluid with an alkaline earth metal hydride or hydroxide. Molecular weight distributions...
5247116 Acid-catalyzed process for the production of cyclosiloxanes  
Cyclosiloxanes are produced by the acid-catalyzed redistribution of siloxane bonds in polysiloxane fluids at a temperature of about 20-200° C. Little catalyst and no water or solvent is required....
5242795 TCL-5 gene rearrangement involved in T-cell leukemia and melanoma  
A gene is described which is involved in the neoplastic process of a number of different cancers. The gene, termed TCL-5, is located at chromosome 1, band 32, adjacent to the chromosome junction...
5238681 Insect bait station  
An insect bait station comprising a first compartment with a hydrated macel containing at least one species of entomopathogen and a second compartment containing a hydrated water retentive...
5229335 Ceramic materials and their synthesis by a xerogel process  
The invention provides a process for producing high phase purity ceramic materials through the utilization of organic gelling agents. The process comprises the following steps: (a) dissolving...
5228119 Multi-dimensional graphing in two-dimensional space  
A method and system for displaying a function in two dimensions where the function is made up of numerous independent variables and at least one dependent variable. A new independent variable...
5198338 Molecular probing for human T-cell leukemia and lymphoma  
A very specific area of chromosome 10, band q11 is taught to be the site of chromosome breakpoints which occur in the course of translocations. The translocation brings sequences of the T-cell...
5188897 Encapsulated 2',5'-phosphorothioate oligoadenylates  
Optically active compounds of the formula ##STR1## wherein n is 1 or 2 and m is 0, 1, 2 or 3 have antiviral activity. Compounds of the formula wherein at least one of the internucleotide...
5185323 Suppression of megakaryocytopoiesis employing platelet factor 4 antimaturation factor  
Antimaturation factor (platelet factor 4 or active peptide segments thereof) is employed in the clinical treatment of coagulation disorders as an anticoagulant operating via an autoregulator...
5158536 Lung cancer hyperthermia via ultrasound and/or convection with perfiuorochemical liquids  
A hyperthermic treatment of lung cancer, by temporarily filling with a liquid medium preselected pulmonary air passages adjoining pulmonary tissues containing malignant cells, circulating...
5158364 Method of making and using an improved liquid crystal cumulative dosimeter container  
A method of making and using a liquid crystal cumulative dosimeter container including a resilient outer body sealed to confine a first liquid crystal composition constituent and a second liquid...
5149965 Precision radiography scaling device  
At least one radiopaque sphere of known dimensions with means for positioning same in a radiographic image field and a method for scaling radiographic images including straight AP and lateral...
5149628 Methods for detecting bcl-3 gene in human leukemias  
Bcl-3 gene sequences can be used to monitor the success of chemotherapy and to detect minimal residual disease in patients having hematopoietic malignancies. Bcl-3 sequences can also be used to...
5143709 Process for production of graphite flakes and films via low temperature pyrolysis  
Electrically conductive carbon flakes and films are prepared in high yield by the pyrolysis of cyclic aromatic hydrocarbons, optionally halogenated, in the presence of a dehydrogenating agent at...
5141744 Insecticide delivery system and attractant  
An insecticidal composition in the form of a hydrated macrogel containing at least one species of entomopathogen and a hydrated water retentive compound which acts as a water-reservoir for the...
5132117 Aqueous core microcapsules and method for their preparation  
A microcapsule comprising an aqueous core, and capsular membrane formed from the interfacial reaction product of a hydrophilic polymeric Lewis acid or salt thereof with a lipophilic Lewis base or...
5126439 Artificial DNA base pair analogues  
The present invention is directed to new artificial base pairs comprising complementary artificial purines and pyrimidines and methods of using artificial complementary base pairs.
5122115 Multilumen angiography catheter  
A multiple lumen catheter specifically adapted for selective visualization of one or the other of the coronary arteries. One lumen of the multiple lumen catheter is adapted to deliver contrast...
5112804 Pharmaceutical composition and method of intranasal administration  
A composition and method for nasal administration of pharmaceuticals utilizes glycyrrhetinic acid as an absorption enhancer. The composition comprises an effective amount of the pharmaceutically...
5110215 Container for liquid crystal cumulative dosimeter  
A container for a liquid crystal cumulative dosimeter including a resilient outer body sealed to confine a first liquid crystal composition constituent and a second liquid crystal composition...
5108420 Aperture occlusion device  
A device consisting of a wire for occluding an aperture within a body surface, such as atrial and ventricular septal defects (and the method of using such a device). The wire comprises two...
5104704 Gel-interleaved tamper-evident wrap  
A tamper evident over-wrap is disclosed which employs a multi-layered system including three overlapping layers of containment material and two interleaved layers of reactive material, at least...
5098890 Antisence oligonucleotides to c-myb proto-oncogene and uses thereof  
Oligonucleotides are provided having a nucleotide sequence complementary to at least a portion of the mRNA transcript of the human c-myb gene. These "antisense" oligonucleotides are hybridizable...
5093198 Adjuvant-enhanced sustained release composition and method for making  
Improved sustained-release delivery forms comprising Lewis acid-Lewis base salt microparticulate material modified by the addition of at least one additional constituent known as an "adjuvant"...
5066592 Trigramin - a platelet aggregation inhibiting polypeptide  
Trigramin, a 72-amino acid polypeptide, has the following amino acid sequence: EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCN GRSAGCPRNPFH. The molecule is a potent inhibitor of...
5047323 Method for detecting human kininogen using monoclonal antibodies thereto  
Two novel cell lines, ATCC #HB-8963 and ATCC #HB-8964 produce monoclonal antibody to human kininogen. One of the antibodies specifically recognizes the heavy chain of high and low molecular weight...
4990498 2- and 8-azido(2'-5')oligoadenylates and antiviral uses thereof  
Compounds of the formula ##STR1## REFERENCE TO GOVERNMENT GRANT The invention described herein was made, in part, in the course of work supported by National Institutes of Health Grants GM 27210...
4978662 2-substituted trimethylpyrazine derivatives as inhibitors of platelet function  
Novel 2-substituted trimethylpyrazine derivatives of the formula: ##STR1## wherein R is alkylamino, 4-methyl-1-piperazinyl, piperidino, morpholino or 2-trimethylpyrazinepropenyl.These novel...
4975463 Ethyl(or methyl) 4-acetoxy(or propionyloxy)-5,6,7 or 8-di(or tri-)substituted-2-naphthoates  
Novel antiviral ring-substituted ethyl or methyl 4-acetoxy (or propionyloxy)-2-naphthoates are provided.
4966817 Transition-metal-carbon composites and methods for making  
Carbon-transition metal composite formed via pyrolytic decomposition of a polycyanogen in the presence of a transition metal or a salt thereof.
4963657 Monoclonal antibodies to the light chain region of human factor XII and methods of preparing and using the same  
Novel cell lines produce monoclonal antibody to the light chain region of human factor XII. Three such cell lines, ATCC #HB-9703 through ATCC #HB-9704, are formed by fusing SP2/0-Ag14 myeloma...