Patents and Patent Applications from Temple University


Match Document Document Title
5098890 Antisence oligonucleotides to c-myb proto-oncogene and uses thereof  
Oligonucleotides are provided having a nucleotide sequence complementary to at least a portion of the mRNA transcript of the human c-myb gene. These "antisense" oligonucleotides are hybridizable...
5093198 Adjuvant-enhanced sustained release composition and method for making  
Improved sustained-release delivery forms comprising Lewis acid-Lewis base salt microparticulate material modified by the addition of at least one additional constituent known as an "adjuvant"...
5066592 Trigramin - a platelet aggregation inhibiting polypeptide  
Trigramin, a 72-amino acid polypeptide, has the following amino acid sequence: EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCN GRSAGCPRNPFH. The molecule is a potent inhibitor of...
5047323 Method for detecting human kininogen using monoclonal antibodies thereto  
Two novel cell lines, ATCC #HB-8963 and ATCC #HB-8964 produce monoclonal antibody to human kininogen. One of the antibodies specifically recognizes the heavy chain of high and low molecular weight...
4990498 2- and 8-azido(2'-5')oligoadenylates and antiviral uses thereof  
Compounds of the formula ##STR1## REFERENCE TO GOVERNMENT GRANT The invention described herein was made, in part, in the course of work supported by National Institutes of Health Grants GM 27210...
4978662 2-substituted trimethylpyrazine derivatives as inhibitors of platelet function  
Novel 2-substituted trimethylpyrazine derivatives of the formula: ##STR1## wherein R is alkylamino, 4-methyl-1-piperazinyl, piperidino, morpholino or 2-trimethylpyrazinepropenyl.These novel...
4975463 Ethyl(or methyl) 4-acetoxy(or propionyloxy)-5,6,7 or 8-di(or tri-)substituted-2-naphthoates  
Novel antiviral ring-substituted ethyl or methyl 4-acetoxy (or propionyloxy)-2-naphthoates are provided.
4966817 Transition-metal-carbon composites and methods for making  
Carbon-transition metal composite formed via pyrolytic decomposition of a polycyanogen in the presence of a transition metal or a salt thereof.
4963657 Monoclonal antibodies to the light chain region of human factor XII and methods of preparing and using the same  
Novel cell lines produce monoclonal antibody to the light chain region of human factor XII. Three such cell lines, ATCC #HB-9703 through ATCC #HB-9704, are formed by fusing SP2/0-Ag14 myeloma...
4925841 Mannich bases of spirosuccinimides  
Mannich bases of spirosuccinimides are provided having anticonvulsant, sedative and antileukemic activity. The compounds have the following formula wherein ring A is a saturated or unsaturated...
4924624 2,',5'-phosphorothioate oligoadenylates and plant antiviral uses thereof  
Optically active compounds of the formula ##STR1## wherein n is 1 or 2 and m is 0, 1, 2 or 3 have antiviral activity. Compounds of the formula wherein at least one of the internucleotide...
4922897 Apparatus and method for reconstructive surgery  
A method and apparatus for the permanent surgical reconstruction of the anterior cruciate ligament in the human knee, which will stabilize the tibia and femur relative to each other and restore a...
4917892 Encapsulated topical delivery system  
Delivery system for topical application comprising a highly viscous carrier containing dissolved or dispersed and microencapsulated topically-active agents providing immediate and sustained...
4908431 Monoclonal antibodies to human kininogen and methods of preparing same  
Two novel cell lines, ATCC #HB-8963 and ATCC #HB-8964 produce monoclonal antibody to human kininogen. One of the antibodies specifically recognizes the heavy chain of high and low molecular weight...
4882272 High molecular weight kininogen assay  
An assay for functional high molecular weight kininogen in plasma is provided. A plasma sample of unknown functional high molecular kininogen content is treated to inactivate plasma protease...
4867963 Enhancement of NMR imaging of tissue by paramagnetic pyrophosphate contrast agent  
Nuclear magnetic resonance imaging of animal or human tissue is enhanced when a paramagnetic pyrophosphate compound is administered intraveneously as a contrast agent. The contrast agent is...
4866998 Medical examination table with probe holder  
A method of predicting the occurrence of deep vein thrombosis after a surgical procedure comprises monitoring changes in the internal diameter of a blood vessel using a non-invasive ultrasound...
4866030 Method of producing high temperature superconductors by a molten hydroxide process  
The present invention is directed to a method of producing metal oxides which are useful as high temperature superconductors. The method comprises the steps of: (a) mixing generally stoichiometric...
4859768 Derivatives of 2', 5'-oligoadenylate and antiviral uses thereof  
Synthetic analogs of 2',5'-oligoadenylate wherein the aglycon, ribosyl moiety and/or terminal nucleoside have been modified are effective antiviral agents for pharmaceutical and agricultural use....
4818685 Method and kit for diagnosing bloom's syndrome  
A method and kit for diagnosing Bloom's syndrome are provided relying on specific monoclonal antibodies, such as ATCC HB-9311, which recognize the base excision repair pathway enzyme uracil DNA...
4808088 Pneumatic drive circuit for an artificial ventricle including systolic pressure control  
A pneumatic drive circuit for a pneumatically-driven artificial ventricle having a gas chamber and a blood chamber separated by a flexible diaphragm. The drive circuit comprises a source of...
4807482 Method and apparatus for measuring stimuli applied to a piezoelectric transducer  
A method of and apparatus for measuring a stimulus, e.g. a force, applied to a piezoelectric transducer. The method comprises sampling the output of the transducer in response to the stimulus at...
4806465 Cytoplasmic antigens of candida albicans and methods of using the same  
Two novel hybridoma cell lines, ATCC #HB-8397 and ATCC #HB-8398 produce monoclonal antibody monospecific to a single determinant shared by a set of three closely related cytoplasmic antigens of...
4797234 Production of sustained release composition from salt-form reactants  
Sustained-released delivery forms comprising the reaction product of a Lewis acid salt with a Lewis base salt at the phase interface of their respective aqueous and non-aqueous solution to form an...
4781715 Cardiac prosthesis having integral blood pressure sensor  
An integral blood pressure sensor for a cardiac prosthesis of the type having a fluid chamber and a blood chamber separated by a flexible diaphragm which is actuated by a drive fluid pulsatingly...
4758562 Method for inducing hypothermia and/or poikilothermia  
A combination of drugs including a kappa opioid receptor agonist and a dopamine receptor blocker or dopamine receptor agonist provides a synergistic effect in inducing hypothermia and/or...
4743583 Sustained release protein compositions and method for making  
Lewis acid-Lewis base high molecular weight salt microparticulate material of the type referred to in U.S. Pat. No. 3,959,457, which include biologically active peptides and proteins solubilized...
4740306 Chromatographic column  
A chromatographic column and process for isolating or purifying steroid hormone or cell membrane receptors using the column are provided in which the column contains at least three resin layers...
4739751 Apparatus and method for reconstructive surgery  
A method and apparatus for the permanent surgical reconstruction of the anterior cruciate ligament in the human knee, which will stabilize the tibia and femur relative to each other and restore a...
4721113 Method of predicting the occurrence of deep vein thrombosis by non-invasive measurement of vessel diameter  
A method of predicting the occurrence of deep vein thrombosis after a surgical procedure comprises monitoring changes in the internal diameter of a blood vessel using a non-invasive ultrasound...
4719158 Process and apparatus for converting rocking motion into electrical energy  
A device and method for converting ocean wave energy into electricity either on moored buoys or in small vessels. The device and method of the invention utilize a U-shaped tube in communication...
4705171 Wrapper for delivering sterile disposables  
The present invention is directed to an improved package for wrapping sterile disposable articles, such as surgical gowns. The package generally includes a generally rectangular wrapping material...
4677038 Gas concentration cells for utilizing energy  
An apparatus and method for utilizing energy, in which the apparatus may be used for generating electricity or as a heat pump. When used as an electrical generator, two gas concentration cells are...
4670382 Monoclonal antibody to Candida albicans cytoplasmic antigens and methods of preparing same  
Two novel hybridoma cell lines, ATCC #HB-8397 and ATCC #HB-8398 produce monoclonal antibody monospecific to a single determinant shared by a set of three closely related cytoplasmic antigens of...
4657349 Electro- and magneto-optic devices  
An electro- and magneto-optic device which comprises a fluid suspension of anisotropic platelets in a dielectric media, and a means for imposing an electrical or magnetic field on the suspension....
4649038 Cyanogen polymers and pyropolymers and fibers thereof  
A novel polycyanogen (MW at least 500) is made by electrochemical polymerization of cyanogen in solution. Fiber and pyrolyzed forms of this polymer and methods of making same are also described.
4596769 Monoclonal antibodies to peptidoglycan and methods of preparing same  
Several novel hybridoma cell lines, ATCC #HB-8510, 8511, 8512, 8513, 8514, 8515, 8516, and 8517 produce monoclonal antibody to an antigen, peptidoglycan, which is a normal structural component of...
4460492 Low viscosity lyotropic cholesteric liquid crystal compositions  
A low viscosity, short pitch, cholesteric liquid crystal composition consisting of an alkali cromoglycate dissolved in water or water with a polar solvent, together with an optically active solute...
4446230 Test method for the laboratory diagnosis of Gonorrhea and test strain of neisseria gonorrhoeae  
A strain of Neisseria gonorrhoeae ATCC 31953 is described which is abnormal in that it has characteristically poor growth on chocolate agar at a temperature range of about 30° C. to about 37° C....
4427646 Use of radiolabeled peptide derived from crosslinked fibrin to locate thrombi in vivo  
A method of locating thrombi in vivo comprising the steps of administering a radiolabeled peptide selected from the group consisting of Fragment E1 isolated from cross-linked fibrin, Fragment E2...
4335093 Process of converting wind energy to elemental hydrogen and apparatus therefor  
A system is described for the conversion of the energy in the wind over oceanic regions into hydrogen which can be used as a supplement to or replacement for fossil fuels. The system is based on...
4323561 Process of enhancing immmunogenic response in mammals by the administration of synthetic glycolipid adjuvants  
A process is described for enhancing the immunogenic response of mammals. N-acylated-D-glucosamines were administered parenterally in the form of liposomes to mice at or before the time of...
4293193 Amine-substituted liquid crystal compositions  
A group of novel, low temperature liquid crystalline compounds with terminal, primary or secondary amino polar electron donating groups are disclosed. These include, for example, p-alkyl-or...
4241149 Canal clathrate complex solid electrolyte cell  
An electrolytic cell wherein one of the elements is comprised of a canal clathrate complex of benzophenone and a polyiodide salt of a cation from a group consisting of potassium (K+), sodium...
4178517 Process for conversion of ocean wave energy into electric power and apparatus  
A method and apparatus is provided for direct conversion of ocean wave energy into electric power. The apparatus has no moving parts, and uses wave motion to vary the pressure of hydrogen gas in...
4176918 Fluorescent liquid crystal display  
A liquid crystal composition for improved electro-optic displays. The composition undergoes an electrically induced cholesteric-nematic phase transition and includes fluorescent materials which...
4170477 Method for making polysulfur nitride and product thereof  
Irradiation of collected S4 N4 decomposition products with light or radiation in the γ to visible range enhances the initiation of polymerization of the decomposition products to produce...
4155352 Nystagmus processor for EEG machines  
A pair of active probes and a datum probe are affixedto the patient, and the active probes' signals are coupled to a preamplifier involving both common mode rejection and differential...
4138358 Liquid crystal compositions  
Liquid crystal mixtutre of donor and acceptor molecules, the first consisting of a liquid crystal compound having an unshared electron pair (the donor) and the second generally consisting of an...
4104204 Photosensitization of oxygen to the singlet excited state using ion exchange resin to which is attached a dye and photooxidative waste water treatment  
A composition and method for the oxidation of organic contaminants in waste water by subjection to heterogeneous photosensitized oxidation is disclosed.