Title:
New aptamer that specifically binds to human tau protein or its fragment, useful e.g. in vitro for isolating, purifying and/or detecting tau protein, and to treat cerebral infarction, pick disease and/or progressive supranuclear palsy
Kind Code:
A1
Abstract:
Aptamer that specifically binds to human tau protein or its fragment, is new. Independent claims are included for: (1) kit comprising the aptamer; (2) a method for the purification of human tau protein or its fragments comprising contacting a sample containing human tau protein or its fragments with the aptamer and separating the obtained complex of aptamer and bound tau protein or its fragments from the remaining sample; and (3) a method for detection of human tau protein or its fragments comprising contacting a sample to be tested with the aptamer and detecting a binding event between the aptamer and the human tau protein or its fragment. ACTIVITY : Cerebroprotective; Vasotropic; Neuroprotective; Nootropic; Antiparkinsonian. MECHANISM OF ACTION : None given.


Inventors:
Stoltenburg, Regina, Dr. (04157, Leipzig, DE)
Strehlitz, Beate, Dr. (04279, Leipzig, DE)
Reinemann, Christine, Dr. (04275, Leipzig, DE)
Application Number:
DE102010038842A
Publication Date:
02/09/2012
Filing Date:
08/03/2010
Assignee:
Helmholtz-Zentrum für Umweltforschung GmbH - UFZ, 04318 (DE)
Other References:
Brandt R, Lee G.: Functional organization of microtubule-associated protein tau. Identification of regions which affect microtubule growth, nucleation, and bundle formation in vitro. In: J Biol Chem., 268(5), 1993 Feb 15, 3414-9.
Krylova SM, Musheev M, Nutiu R, Li Y, Lee G, Krylov SN.: Tau protein binds single-stranded DNA sequence specifically--the proof obtained in vitro with non-equilibrium capillary electrophoresis of equilibrium mixtures.. In: FEBS Lett., 579(6), 2005 Feb 28; Epub 2005 Jan 28, 1371-5.
Lee G, Rook SL.: Expression of tau protein in non-neuronal cells: microtubule binding and stabilization. In: J Cell Sci., 102 ( Pt 2), 1992 Jun, 227-37.
Stoltenburg R, Reinemann C, Strehlitz B.: FluMag-SELEX as an advantageous method for DNA aptamer selection. In: Anal Bioanal Chem., 383(1), 2005 Sep; Epub 2005 Oct 19, 83-91.
Wikipedia Artikel "Aptamer" (Version vom 20.7.2010; http://de.wikipedia.org/w/index.php?title=Aptamer&oldid=76866868)
Attorney, Agent or Firm:
Anwaltskanzlei Gulde Hengelhaupt Ziebig & Schneider, 10179, Berlin, DE
Claims:
1. Aptamer, welches spezifisch an humanes Tau-Protein oder ein Fragment davon bindet.

2. Aptamer nach Anspruch 1, dadurch gekennzeichnet, dass das Aptamer mindestens eine der folgenden Nukleinsäuresequenzen umfasst oder daraus besteht:
a) eine Sequenz mit einer der SEQ ID Nrs 2 bis 27; oder
b) eine Sequenz, die zu mindestens 80% identisch ist mit einer Sequenz aus a) über eine Abfolge von mindestens 18 aufeinanderfolgenden Nukleotiden.

3. Aptamer nach Anspruch 2, dadurch gekennzeichnet, dass die Sequenz in a) ausgewählt ist aus SEQ ID Nrs 2 bis 14.

4. Aptamer nach einem der Ansprüche 2 oder 3, dadurch gekennzeichnet, dass die Sequenz in a) ausgewählt ist aus SEQ ID Nrs 2, 10, 11, 12 und/oder 14.

5. Aptamer nach Anspruch 2, dadurch gekennzeichnet, dass die Sequenz in a) ausgewählt ist aus SEQ ID Nrs 15 bis 27.

6. Aptamer nach einem der vorhergehenden Ansprüche, dadurch gekennzeichnet, dass es sich um ein DNA-Aptamer handelt.

7. Aptamer nach einem der vorhergehenden Ansprüche, dadurch gekennzeichnet, dass die Nukleinsäure des Aptamers an ein Trägermolekül und/oder ein Reportermolekül konjugiert vorliegt und/oder zusätzliche Nukleotidsequenzen enthält.

8. Aptamer nach einem der vorhergehenden Ansprüche, dadurch gekennzeichnet, dass das Aptamer an humanem Tau-Protein mit der SEQ ID Nr. 1 eine KD aufweist von nicht mehr als 500 nM.

9. Pharmazeutische Zusammensetzung, dadurch gekennzeichnet, dass die pharmazeutische Zusammensetzung ein Aptamer nach einem der Ansprüche 1 bis 8 enthält und mindestens einen pharmazeutisch annehmbaren Hilfsstoff.

10. Kit umfassend ein Aptamer nach einem der Ansprüche 1 bis 8.

11. Aptamer nach einem der Ansprüche 1 bis 8, pharmazeutische Zusammensetzung nach Anspruch 9 oder Kit nach Anspruch 10 für die Verwendung in der Diagnose und/oder Therapie von Erkrankungen, die mit einer Veränderung im Tau-Proteinspiegel einhergehen, insbesondere von Hirninfarkt, Schlaganfall, Creutzfeld-Jakob-Erkrankung, Taupathien, Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und/oder progressive supranukleäre Blickparese.

12. Verwendung eines Aptamers nach einem der Ansprüche 1 bis 8 oder einer pharmazeutischen Zusammensetzung nach Anspruch 9 zur Herstellung eines Medikaments, bevorzugt zur Herstellung eines Medikaments für die Diagnose von Erkrankungen, die mit einer Veränderung im Tau-Proteinspiegel einhergehen, insbesondere von Hirninfarkt, Schlaganfall, Creutzfeld-Jakob-Erkrankung, Taupathien, Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und/oder progressive supranukleäre Blickparese.

13. Verwendung eines Aptamers nach einem der Ansprüche 1 bis 8 in vitro für die Isolierung, Reinigung und/oder zum Nachweis von Tau-Protein oder Fragmenten davon.

14. Verfahren zur Aufreinigung von humanem Tau-Protein oder Fragmenten davon, dadurch gekennzeichnet, dass eine Probe, enthaltend humanes Tau-Protein oder ein Fragment davon, mit mindestens einem Aptamer nach einem der Ansprüche 1 bis 8 kontaktiert wird und der erhaltene Komplex aus Aptamer und gebundenem Tau-Protein oder dem Fragment davon von der restlichen Probe abgetrennt wird.

15. Verfahren zum Nachweis von humanem Tau-Protein oder Fragmenten davon, dadurch gekennzeichnet, dass die zu untersuchende Probe mit mindestens einem Aptamer nach einem der Ansprüche 1 bis 8 kontaktiert wird und ein Bindungsereignis zwischen dem Aptamer und humanem Tau-Protein oder einem Fragment davon nachgewiesen wird.

Description:

Bei neurodegenerativen Erkrankungen und insbesondere bei Morbus Alzheimer kommt es meist zu einer pathologischen Veränderung des Gehirns, lange bevor andere Krankheitssymptome auftreten. Biomarker, die solche präklinischen Phasen anzeigen und eine Differenzierung zwischen verschiedenen neurodegenerativen Krankheiten erlauben, sind daher für eine frühzeitige Diagnose und Therapie bedeutsam. Dadurch kann die Lebensqualität der Betroffenen möglichst lange erhalten werden und die Pflegekosten für das Gesundheitssystem können insgesamt verringern werden.

Derzeit beruht die Diagnose bei Morbus Alzheimer auf Gedächtnis- und Verhaltenstests sowie bildgebenden Verfahren. Ein definitiver Nachweis der Erkrankung ist erst durch Autopsie nach dem Tod des Patienten möglich.

Wie K. Bracht in ”Indikatoren für Diagnose und Therapie”; Pharmazeutische Zeitung online Ausgabe 12/2009; http://www.pharmazeutische-zeitung.de/index.php?id=29346&type=0; zusammenfasst, sind in Studien bereits Liquor-Untersuchungen auf Amyloid-β42-Peptid (Aβ42) und Tau-Protein verfügbar. Dabei hat sich gezeigt, dass erhöhte Tau-Protein-Spiegel mit Alzheimer-Demenz assoziiert sind.

Tau-Protein bindet normalerweise an Mikrotubulin und stabilisiert dieses. Vermutlich stammen die bei Alzheimer erhöhten Tau-Proteinspiegel in Cerebrospinalflüssigkeit (CSF) aus sterbenden Neuronen. Einige Gruppen erforschen eine Alzheimer-spezifische Phosphorylierung des Moleküls. Tau-Protein wird bei Alzheimer-Patienten abnormal hyperphosphoryliert, wodurch das Gleichgewicht der Tau-Mikrotubulin-Bindung gestört wird. Es konnte gezeigt werden, dass humanes Tau-Protein mit bestimmten Phosphorylierungsmustern als Prädiktor für die Progression einer milden kognitiven Beeinträchtigung zur Alzheimer-Demenz verwendet werden können.

Der Quotient Tau/Aβ42, gemessen in CSF, hat in Studien die derzeit beste prädiktive Aussagekraft für eine zukünftige Demenzerkrankung bei asymptomatischen Probanden.

Neben Morbus Alzheimer ist eine Veränderung im Tau-Proteinspiegel auch mit anderen Erkrankungen und pathologischen Zuständen assoziiert. So ist ein erhöhter oder ein veränderter Tau-Proteinspiegel auch bei Erkrankungen mit einem massiven akuten Neuronenzerfall, wie beispielsweise Hirninfarkten und Schlaganfall, beschrieben worden, wie auch bei chronischem Neuronenuntergang, während atropisch-degenerativer Prozesse und Creutzfeld-Jakob-Erkrankung (siehe auch Hort et al., ”Bedeutung der Gesamt-Tau und Phospho-Tau-Protein-Liquorspiegel in der Demenzdiagnostik”, Nervenarzt 2008, 79, 891–898). Daneben ist eine ganze Gruppe von neurodegenerativen Erkrankungen aufgrund des gemeinsamen Merkmals des erhöhten oder veränderten Tau-Proteinspiegels im Gehirn unter dem Begriff der Taupathien zusammengefasst (klassifiziert in MeSH, Version 2010, unter der Nr. DO24801). Zur Gruppe der Taupathien zählen insbesondere Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und progressive supranukleäre Blickparese.

Der Nachweis des Tau-Proteins erfolgt dabei bislang im Wesentlichen mittels spezifischer Antikörper. Dabei müssen die üblicherweise mit Antikörpern assoziierten Nachteile in Kauf genommen werden. Allgemein bekannte Nachteile von Antikörpern umfassen die Möglichkeit von Kreutzreaktivitäten, eine kostenintensive Herstellung, hohe Variation in der Herstellung und Nachteile, die allgemein mit der Größe von Antikörpern zusammenhängen. Es besteht somit ein Bedarf an Alternativen für den Nachweis von Tau-Protein.

Aufgabe der vorliegenden Erfindung ist es, Alternativen bereitzustellen, bei denen ein oder mehrere Nachteile des Standes der Technik nicht mehr auftreten oder nur noch vermindert vorhanden sind.

Die Aufgabe wird gelöst durch Bereitstellung von Aptameren, die spezifisch an humanes Tau-Protein oder ein Fragment davon binden.

Bevorzugt zeichnet sich das erfindungsgemäße Aptamer dadurch aus, dass das Aptamer mindestens eine der folgenden Nukleinsäuresequenzen umfasst oder daraus besteht:

  • a) eine Sequenz mit einer der SEQ ID Nrs 2 bis 27; oder
  • b) eine Sequenz, die zu mindestens 80% identisch ist mit einer Sequenz aus a) über eine Abfolge von mindestens 18 aufeinanderfolgenden Nukleotiden.

Unter dem Begriff ”Aptamer” sind im Sinne dieser Erfindung Oligonukleotide zu verstehen, die spezifisch und mit hoher Affinität an ein Zielmolekül, Insbesondere humanes Tau-Protein oder ein Fragment davon, binden. Aptamere können sich unter definierten Bedingungen in eine spezifische dreidimensionale Struktur, beispielsweise so genannte Haarnadelstrukturen, falten. Vorzugsweise weist das erfindungsgemäße Aptamer wenigstens eine erste Haarnadel-Struktur umfassend einen Stamm und eine Schleife auf. Unter dem Begriff ”Haarnadelstruktur” oder ”Hairpin” ist im Sinne der vorliegenden Erfindung eine spezielle Form der Sekundärstruktur bei Nukleinsäuresequenzen, insbesondere Aptameren, zu verstehen, die sich aus zwei zueinander komplementären Sequenz-Abschnitten im so genannten Stamm (stem) und einem weiteren Sequenzabschnitt in der so genannten Schleife (loop) zusammensetzen, zu verstehen. Hierbei können im Stamm eine oder mehrere Basen einzelsträngige Bereiche so genannte Ausbuchtungen (Bulge) ausbilden.

Das erfindungsgemäße Aptamer enthält oder besteht aus einer Sequenz von Nukleinsäurebausteinen, den Nukleotiden. Bevorzugt werden im erfindungsgemäßen Aptamer unmodifizierte und/oder modifizierte D- und/oder L-Nukleotide verwendet. ”C” steht vorliegend entsprechend dem üblichen, hier verwendeten Ein-Buchstaben-Code der Basen für Cytosin, entsprechend stehen ”A” für Adenin, ”G” für Guanin und ”T” für Thymin, ”U” für Uracil. Wenn im Folgenden nicht anders angegeben, umfasst der Begriff ”Nukleotid” die Begriffe ”Ribonukleotid” und ”Desoxyribonukleotid”. Entsprechend umfasst der Begriff ”2'-Fluoro-, 2'-Methoxy- und/oder 2'-Amino-modifiziertes Nukleotid” 2'-Fluoro-, 2'-Methoxy- und/oder 2'-Amino-modifizierte Ribonukleotide und Desoxyribonukleotide.

Das erfindungsgemäße Aptamer weist bevorzugt eine Anzahl an Nukleotiden im Bereich von ≥ 18 Nukleotide bis ≤ 160 Nukleotide, vorzugsweise im Bereich von ≥ 40 Nukleotide bis ≤ 120 Nukleotide, auf. Besonders bevorzugt weist das erfindungsgemäße Aptamer eine Anzahl an Nukleotiden im Bereich von ≥ 44 Nukleotide bis ≤ 120 Nukleotide, vorzugsweise im Bereich von ≥ 50 Nukleotide bis ≤ 88 Nukleotide bevorzugt im Bereich von ≥ 60 bis ≤ 80 Nukleotide auf.

Erfindungsgemässe Aptamere können eine DNA- oder eine RNA-Sequenz aufweisen. Es versteht sich, dass für den Fall, dass erfindungsgemässe Aptamere eine RNA-Sequenz aufweisen, in den angegebenen Sequenzmotiven und Sequenzen Thymidin durch Uridin ersetzt ist. Die erfindungsgemäss geeigneten RNA-Sequenzen entsprechen den erfindungsgemässen DNA Sequenzen, wobei T durch U ersetzt ist.

Vorzugsweise weisen die erfindungsgemäßen Aptamere eine DNA-Sequenz auf oder bestehen daraus. Aptamere auf DNA-Basis besitzen in vorteilhafter Weise eine erhöhte Stabilität.

Weiterhin geeignet sind Aptamere, die eine Sequenz umfassend 2'-modifizierte Nukleotide, beispielsweise 2'-Fluoro-, 2'-Methoxy- und/oder 2'-Amino-modifizierte Nukleotide, aufweisen. Auch geeignet sind Aptamere, die 2'-modifizierte Ribonukleotide, beispielsweise 2'-Fluoro-, 2'-Methoxy- und/oder 2'-Amino-modifizierte Ribonukleotide, aufweisen. Weiterhin können Aptamere Desoxyribonukleotide und 2'-modifizierte Ribonukleotide, beispielsweise 2'-Fluor-, 2'-Methoxy- und/oder 2'-Amino-modifizierte Ribonukleotide aufweisen.

Das erfindungsgemäße Aptamer kann Modifikationen aufweisen. Unter Modifikationen können z. B. die Alkylierung, insbesondere Methylierung, Arylierung oder Acetylierung von zumindest einem Nukleotid, den Einbau von Enantiomeren und/oder die Fusion von Aptameren mit einem oder mehreren Nukleotiden oder einer Nukleinsäuresequenz umfassen. Solche Modifikationen können beispielsweise 5'-PEG- und/oder 3'-CAP-Modifikationen umfassen. Alternativ oder zusätzlich kann das erfindungsgemäße Aptamer modifizierte Nukleotide aufweisen, vorzugsweise ausgewählt aus der Gruppe umfassend Locked-Nukleinsäuren, 2'-Fluoro-, 2'-Methoxy- und/oder 2'-Amino-modifizierte Nukleotide.

Locked-Nukleinsäuren (LNA, Locked Nucleic Acid) entsprechen einem konformationsfixierten Analogon von RNA. Die Oligonukleotide der Locked-Nukleinsäuren enthalten ein oder mehrere bizyklische Ribonukleoside, bei denen die 2'OH-Gruppe mit dem C4-Kohlenstoffatom über eine Methylengruppe verbunden ist. Vorteilhafter Weise zeigen Locked-Nukleinsäuren im Vergleich zu nicht modifizierter RNA eine höhere Stabilität gegenüber Nukleasen sowie bessere Hybridisierungseigenschaften, wodurch eine Verbesserung der Affinität und/oder Spezifität der Bindung des Aptamers erzielt werden kann.

Eine weitere bevorzugte chemische Modifikation ist das 5'- oder 3'-Capping der Aptamersequenz. Die Modifikation des 3'-Endes oder 5'-Endes kann das Aptamer in vorteilhafter Weise vor einem schnellen Abbau durch Nukleasen, insbesondere in einem Organismus oder einer biologischen Probe schützen. Beispielsweise bietet die Einführung. eines 3'-3'-dT-Cap am 3'-Ende eines Aptameres Schutz gegenüber Exonukleasen.

In anderen Ausführungsformen kann insbesondere das 5'-Ende des Aptamers pegyliert sein. Eine 5'-PEG-Modifikationen kann beispielsweise wenigstens eine Polyethylenglykol-Einheit umfassen, bevorzugt im Bereich von 1 bis 900 Polyethylenglykol-Einheiten, vorzugsweise im Bereich von 1 bis 450 Polyethylenglykol-Einheiten. Bevorzugt verwendbar sind lineare Polyethylenglykol(PEG)-Einheiten HO-(CH2CH2O)n-H, wobei n eine ganze Zahl im Bereich von 1 bis 900, bevorzugt im Bereich von 1 bis 450 ist.

In einer anderen Ausführungsform der vorliegenden Erfindung können die erfindungsgemässen Aptamere als Phosphorothioat-DNA oder peptide nucleic acid (PNA) vorliegen. Durch diese Modifikationen können die Aptamere gegen Nukleinsäure-spaltende Enzyme stabilisiert werden. Die Stabilisierung berührt die Affinität der modifizierten DNA-Aptamere im Wesentlichen nicht, kann jedoch die Zersetzung der Aptamere in einem Organismus oder einer biologischen Probe durch abbauende Enzyme wie Nukleasen oder DNasen verzögern, vermindern oder sogar verhindern.

Der Vorteil einer chemischen Modifikation, einer Änderung des Phosphorzuckerrückgrates oder einer Verwendung von enzymatisch nicht erkennbaren veränderten Nukleotidbausteinen ist, dass die verwendeten Nukleinsäuren gegen einen enzymatischen Abbau, insbesondere in einem Organismus oder einer biologischen Probe, stabilisiert sind oder erwünschte pharmakologische Eigenschaften aufweisen. Bevorzugt berührt die Modifikation die Affinität der erfindungsgemäßen Aptamere nicht.

Die erfindungsgemäßen Aptamere können auch an ein Trägermolekül oder ein Reportermolekül konjugiert vorliegen. Unter Trägermolekülen können beispielsweise solche Moleküle verstanden werden, die an ein erfindungsgemäßes Aptamer konjugiert werden, um die Halbwertszeit des erfindungsgemäßen Aptamers in humanem Blut zu erhöhen, z. B. durch Erhöhung der Stabilität und/oder durch Verringerung der Ausscheidungsrate. Beispielhaft sei PEG als geeignetes Trägermolekül genannt. Unter Reportermolekülen werden Moleküle verstanden, die im Wesentlichen der Detektion der daran konjugierten erfindungsgemäßen Aptamere dienen. Beispiele für geeignete Reportermoleküle sind GFP oder Reste mit radioaktiven Verbindungen, insbesondere mit PET-fähigen Radionukliden, wie beispielsweise 18F, 11C, 13N, 15O, 82Rb oder 68Ga. Weitere Beispiele für geeignete Träger- und/oder Reportermoleküle sind Biotin, Amino-Gruppen, Phosphat-Gruppen, Cholesterol, Farbstoffe wie beispielsweise Fluoreszenzfarbstoffe sowie elektrochemisch aktive Reportermoleküle. Darüberhinaus können die Aptamere mit zusätzlichen DNA-Sequenzen modifiziert werden, die als Spacermoleküle dienen oder zur Konstruktion spezieller Messassays, welche eine Hybridisierungs-/Dehybridisierungsreaktion einschließen, verwendet werden können.

Bevorzugt weist das erfindungsgemäße Aptamer mindestens eine der folgenden Nukleinsäuresequenzen auf oder besteht daraus:

  • a) eine Sequenz mit einer der SEQ ID Nrs 2 bis 27; oder
  • b) eine Sequenz, die zu mindestens 80%, bevorzugt mindestens 90%, mindestens 95%, mindestens 99% identisch ist mit einer Sequenz aus a) über eine Abfolge von mindestens 18 aufeinanderfolgenden Nukleotiden, bevorzugt über die gesamte Länge der Sequenz aus a).

In einer bevorzugten Ausführungsform umfasst oder besteht das erfindungsgemäße Aptamer aus:

  • a) eine Sequenz mit einer der SEQ ID Nrs 2 bis 14, besonders bevorzugt SEQ ID Nrs 2, 10, 11, 12, 14; oder
  • b) eine Sequenz, die zu mindestens 80%, bevorzugt mindestens 90%, mindestens 95%, mindestens 99% identisch ist mit einer Sequenz aus a) über eine Abfolge von mindestens 18 aufeinanderfolgenden Nukleotiden, bevorzugt über die gesamte Länge der Sequenz aus a).

In einer anderen bevorzugten Ausführungsform umfasst oder besteht das erfindungsgemäße Aptamer aus:

  • a) eine Sequenz mit einer der SEQ ID Nrs 15 bis 27, besonders bevorzugt mit einer der SEQ ID Nrs 15, 23, 24, 25, 27; oder
  • b) eine Sequenz, die zu mindestens 80%, bevorzugt mindestens 90%, besonders bevorzugt mindestens 95%, ganz besonders bevorzugt mindestens 99%, identisch ist mit einer Sequenz aus a) über eine Abfolge von mindestens 18 aufeinanderfolgenden Nukleotiden, bevorzugt über die gesamte Länge der Sequenz aus a).

Die Sequenzen mit der SEQ ID Nrs 2 bis 14 umfassen die spezifischen Sequenzen der internen Regionen der selektierten Aptamere. Die Sequenzen mit den SEQ ID Nrs 15 bis 27 umfassen die vollständigen Sequenzen der selektierten Aptamere, bestehend aus den internen Regionen (SEQ ID Nrs 2 bis 14) und den konstanten Bereichen, welche die internen Regionen am 5'-Ende bzw. am 3'-Ende flankieren. Diese konstanten Sequenzen stellen ebenso wie die internen Regionen strukturbildende Komponenten der Aptamere dar und dienten zusätzlich als Primerbindungsorte für die Amplifikation der Aptamere im SELEX-Prozess. Sie sind daher ein wesentlicher Teil aller hier aufgeführten Aptamere.

Unter einer Sequenz, die zu mindestens 80% identisch ist mit einer Sequenz mit der SEQ ID Nr. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26 und/oder 27, wird jede Sequenz verstanden, die eine zusammenhängende Nukleotidkette aufweist, die mit einer Sequenz mit der SEQ ID Nr. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26 und/oder 27 über eine Abfolge von 18 aufeinanderfolgenden Nukleotiden insoweit übereinstimmt, dass sich eine Sequenzidentität von mindestens 80% ergibt. Die Sequenzidentität kann beispielsweise mittels des blastn-Algorithmus bestimmt werden (zugänglich über http://blast.ncbi.nlm.nih.gov/Blast.cgi). Bevorzugt weist die Sequenz nach b) eine Sequenzidentität auf von mindestens 90%, besonders bevorzugt mindestens 95%, ganz besonders bevorzugt mindestens 99%, mit einer Sequenz mit der SEQ ID Nr. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26 und/oder 27. Die Sequenzidentität liegt bevorzugt über eine Abfolge von 18 aufeinanderfolgenden Nukleotiden vor, besonders bevorzugt liegt die Sequenzidentität über die gesamte Länge einer Sequenz mit der SEQ ID Nr. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26 und/oder 27 vor.

Verfahren für die Selektion sowie für die Herstellung von Aptameren sind dem Fachmann bekannt. Für die Suche nach Aptameren, die spezifisch für humanes Tau-Protein oder ein Fragment davon sind, kann beispielsweise das SELEX-Verfahren (Systematic Evolution of Ligands by EXponential enrichment) angewendet werden. Hierbei wird ein Pool verschiedener Oligonukleotide mit dem definierten Zielmolekül kontaktiert, bindende Oligonukleotide werden selektiert und amplifiziert und in aufeinanderfolgenden Runden schrittweise im Pool angereichert. Hierzu wird im Einzelnen auf die folgenden Literaturstellen verwiesen: Tuerk & Gold, Science 249 (1990) 505–510, sowie Ellington & Szostak, Nature 346 (1990) 818–822. Die so erhaltenen Oligonukleotide bzw. Aptamere eignen sich beispielsweise zur Detektion von humanem Tau-Protein oder von Fragmenten davon in einem Bindungsassay oder sie können in der Diagnose, Prophylaxe und/oder Therapie von Erkrankungen eingesetzt werden.

Das erfindungsgemäße Aptamer bindet spezifisch an humanes Tau-Protein oder ein Fragment davon. Das Tau-Protein bindet an Mikrotubulinstrukturen, ist an der Regulation des Zytoskeletts beteiligt und wird durch das MAPT-Gen kodiert. Im menschlichen Zentralnervensystem kommen insgesamt 9 Isoformen des humanen Tau-Proteins vor:
Isoform PNS-tau: Diese Isoform umfasst die kanonische Sequenz, die sich aus dem MAPT-Gen ergibt. Diese Sequenz, mit Aminosäuren 2 bis 758, wird für die Zwecke der vorliegenden Erfindung bevorzugt unter dem Begriff ”humanes Tau-Protein” verstanden.
Isoform Fetal-tau: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminosäuren an den Positionen folgendermaßen verändert sind (die Positionen sind jeweils auf die Volllängensequenz des humanen Tau-Proteins mit 758 Aminosäuren bezogen): 45–73, 74–102, 125–375, 395–460 und 592–622 fehlen.
Isoform Tau-A: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminosäuren an den Positionen folgendermaßen verändert sind (die Positionen sind jeweils auf die Volllängensequenz des humanen Tau-Proteins mit 758 Aminosäuren bezogen): 1–44: MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLK → MLRALQQRKR; 45–73, 74–102, 103–104, 125–375, 395–460 und 592–622 fehlen.
Isoform Tau-B: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminosäuren an den Positionen folgendermaßen verändert sind (die Positionen sind jeweils auf die Volllängensequenz des humanen Tau-Proteins mit 758 Aminosäuren bezogen): 74–102, 125–375, 395–460 und 592–622 fehlen.
Isoform Tau-C: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminosäuren an den Positionen folgendermaßen verändert sind (die Positionen sind jeweils auf die Volllängensequenz des humanen Tau-Proteins mit 758 Aminosäuren bezogen): 125–375, 395–460 und 592–622 fehlen.
Isoform Tau-D: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminosäuren an den Positionen folgendermaßen verändert sind (die Positionen sind jeweils auf die Volllängensequenz des humanen Tau-Proteins mit 758 Aminosäuren bezogen): 45–73, 74–102, 125–375 und 395–460 fehlen.
Isoform Tau-E: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminosäuren an den Positionen folgendermaßen verändert sind (die Positionen sind jeweils auf die Volllängensequenz des humanen Tau-Proteins mit 758 Aminosäuren bezogen): 74–102, 125–375 und 395–460 fehlen.
Isoform Tau-F: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminosäuren an den Positionen folgendermaßen verändert sind (die Positionen sind jeweils auf die Volllängensequenz des humanen Tau-Proteins mit 758 Aminosäuren bezogen): 125–375 und 395–460 fehlen.
Isoform Tau-G: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminosäuren an den Positionen folgendermaßen verändert sind (die Positionen sind jeweils auf die Volllängensequenz des humanen Tau-Proteins mit 758 Aminosäuren bezogen): 502-502: S → SATKQVQRRPPPAGPRSER

Das erfindungsgemäße Aptamer kann bevorzugt an solche Isoformen des humanen Tau-Proteins binden, die im menschlichen Gehirn vorkommen, dies sind insbesondere Fetal-Tau, Tau-B, Tau-C, Tau-D, Tau-E und Tau-F.

Das erfindungsgemäße Aptamer bindet besonders bevorzugt spezifisch an ein Peptid des humanen Tau-Proteins mit der SEQ ID Nr. 1, welches die Aminosäuren 226 bis 240 umfasst oder daraus besteht, wobei die Positionen jeweils auf die Aminosäuresequenz der Isoform Tau-441 (= Tau-F, längste der 6 Tau-Isoformen, die im menschlichen Gehirn vorkommen) bezogen sind, oder an ein Fragment davon.

Unter einem Fragment des humanen Tau-Proteins wird jede Aminosäuresequenz verstanden, die mindestens 6, bevorzugt mindestens 10, Aminosäuren umfasst und identisch ist mit einer Sequenz aus einer der 9 Isoformen, bevozugt identisch mit einer Sequenz aus der Volllängensequenz des humanen Tau-Proteins mit 758 Aminosäuren, besonders bevorzugt identisch ist mit einer Sequenz aus der SEQ ID Nr. 1.

Die Bindungsfähigkeit der selektierten Aptamere wird durch die Affinität (Sensitivität) der Bindung (ausgedrückt durch die Dissoziationskonstante KD) beschrieben. In einer bevorzugten Ausführungsform der Erfindung weisen die erfindungsgemäßen Aptamere an humanem Tau-Protein, bevorzugt an dem Peptid mit der SEQ ID Nr. 1 oder einem Fragment davon, eine KD von nicht mehr als 500 nM auf, vorzugsweise nicht mehr als 100 nM, besonders bevorzugt von 0.001 bis 500 nM, ganz besonders bevorzugt von 0.01 bis 100 nM.

Die Erfindung betrifft auch eine pharmazeutische Zusammensetzung, die mindestens eines der erfindungsgemäßen Aptamere umfasst, vorzugsweise zusammen mit mindestens einem pharmazeutisch akzeptablen, annehmbaren oder verträglichen Hilfsstoff und/oder Träger. Eine pharmazeutische Zusammensetzung im Sinne der Erfindung ist jedes Mittel, welches in der Diagnose und/oder Therapie von Patienten eingesetzt werden kann, die zumindest zeitweise eine Erkrankung, eine pathogene Modifikation des Gesamtzustandes bzw. des Zustandes einzelner Teile des Patientenorganismus zeigen.

Die pharmazeutische Zusammensetzung kann das Aptamer als ein akzeptables Salz umfassen. Hierbei kann es sich beispielsweise um Salze anorganischer Säuren, wie z. B. der Phosphorsäure, oder um Salze organischer Säuren handeln. Die jeweilige Dosis bzw. der Dosisbereich für die Gabe der erfindungsgemäßen pharmazeutischen Zusammensetzung ist groß genug, um den gewünschten diagnostischen oder therapeutischen Effekt der Bindung an humanes Tau-Protein oder ein Fragment davon zu erreichen. Im Allgemeinen wird die Dosis mit dem Alter, der Konstitution und dem Geschlecht des Patienten variieren sowie die Schwere der Erkrankung berücksichtigen. Es versteht sich, dass die spezifische Dosis, Häufigkeit und Dauer der Verabreichung darüber hinaus von einer Vielzahl an Faktoren abhängen, wie z. B. der Bindungsfähigkeit der Aptamere, Ernährungsgewohnheiten des zu behandelnden Individuums, Art der Verabreichung, Ausscheidungsrate und Kombination mit anderen Medikamenten. Die individuelle Dosis kann sowohl in Bezug auf die primäre Erkrankung als auch in Bezug auf das Eintreten eventueller Komplikationen eingestellt werden. Die exakte Dosis ist durch einen Fachmann mit bekannten Mitteln und Methoden feststellbar.

In einer Ausführungsform der Erfindung werden die Aptamere in einer Dosis von 0.01 mg bis 1 g pro Kilogramm Körpergewicht und pro Tag verabreicht. Vorzugsweise werden jedoch Dosen von 20 bis 60 mg pro Kilogramm Körpergewicht und pro Tag verabreicht.

Zur Unterstützung der medizinischen Wirkung kann die pharmazeutische Zusammensetzung in einer bevorzugten Ausführungsform der Erfindung auch weitere Wirkstoffe umfassen, wie z. B. eines oder mehrere verschiedene Aptamere und/oder Antikörper.

Erfindungsgemäß ist das Aptamer und/oder die pharmazeutische Zusammensetzung zur diagnostischen oder therapeutischen Behandlung von Erkrankungen geeignet, die mit einer Veränderung im Tau-Proteinspiegel, bevorzugt in humanem Tau-Proteinspiegel, einhergeht. Erkrankungen im Sinne der vorliegenden Erfindung, die mit einem veränderten Tau-Proteinspiegel einhergehen, umfassen Erkrankungen mit einem massiven akuten Neuronenzerfall, wie beispielsweise Hirninfarkte und/oder Schlaganfall, Erkrankungen mit chronischem Neuronenuntergang, Erkrankungen mit atropisch-degenerativen Prozessen und Taupathien. Bevorzugte Erkrankungen, die mit einer Veränderung im Tau-Proteinspiegel einhergehen sind Hirninfarkt, Schlaganfall, Creutzfeld-Jakob-Erkrankung, Taupathien, Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und/oder progressive supranukleäre Blickparese.

Die pharmazeutische Zusammensetzung der vorliegenden Erfindung kann oral, transmucosal, rektal, pulmonal, enteral und/oder parenteral angewendet werden. Bevorzugt ist eine direkte Injektion in den Körper. Die gewählte Art der Verabreichung richtet sich nach der Indikation, der zu verabreichenden Dosis, Individuums-spezifischen Parametern etc. Insbesondere ermöglichen die verschiedenen Arten der Verabreichung eine ortspezifische Therapie, die Nebenwirkungen minimiert und die Wirkstoffdosis verringert. Bevorzugte Injektionen sind die intradermale, subkutane, intramuskuläre oder intravenöse Injektion. Die Applikation kann z. B. mit Hilfe sogenannter Impfpistolen, die die erfindungsgemäßen Aptamere mittels Goldkugeln in die Haut einbringen, oder mittels Spritzen, die die erfindungsgemäßen Aptamere unter die Haut oder in den Muskel einbringen, geschehen. Es ist auch möglich, das Aptamer als Aerosol bereitzustellen, welches von dem Organismus, bevorzugt einem humanen Patienten, inhaliert wird.

Um die protektive oder therapeutische Wirkung der erfindungsgemäßen Aptamere zu erhöhen, können den daraus hergestellten pharmazeutischen Zusammensetzungen pharmazeutisch verträgliche Hilfsstoffe, wie z. B. Adjuvantien, zugesetzt werden. im Sinne der Erfindung ist jede Substanz, die mit den erfindungsgemäßen Aptameren eine Wirkung ermöglicht, verstärkt oder modifiziert, ein Adjuvants. Bekannte Adjuvantien sind beispielsweise Aluminiumverbindungen, wie z. B. Aluminiumhydroxid oder Aluminiumphosphat, Saponine, wie z. B. QS 21, Muramyldipeptid oder Muramyltripeptid, Proteine, wie z. B. Gammainterferon oder TNF, MF 59, Phosphatdibylcholin, Squalen oder Polyole. Des Weiteren kann DNA, die eine immunstimulatorische Eigenschaft hat, oder die ein Protein mit Adjuvants-Effekt kodiert, wie z. B. ein Cytokin, parallel oder in einem Konstrukt appliziert werden.

Das pharmazeutische Mittel kann als Tablette, Kapsel, Pulver, Lösung, Dispersion oder Suspension vorliegen. Die Darreichungsformen des pharmazeutischen Mittels werden mit den üblichen festen oder flüssigen Trägerstoffen und/oder Verdünnungsmitteln und den üblicherweise eingesetzten Hilfsstoffen entsprechend der gewünschten Applikationsart in einer geeigneten Dosierung und in an sich bekannter Weise hergestellt.

Ein weiterer Gegenstand der Erfindung betrifft die Verwendung der erfindungsgemäßen Aptamere zur Diagnose oder Therapie von Erkrankungen, die mit einer Veränderung in humanem Tau-Proteinspiegel einhergehen, insbesondere von Hirninfarkt, Schlaganfall, Creutzfeld-Jakob-Erkrankung, Taupathien, Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und/oder progressive supranukleäre Blickparese.

Noch ein weiterer Gegenstand der Erfindung betrifft die Verwendung dieser Aptamere zur Herstellung eines Medikaments zur Diagnose oder Therapie von Erkrankungen, die mit einer Veränderung im Tau-Proteinspiegel einhergehen, insbesondere von Hirninfarkt, Schlaganfall, Creutzfeld-Jakob-Erkrankung, Taupathien, Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und/oder progressive supranukleäre Blickparese.

Unter dem Begriff ”Diagnose” wird, für die Zwecke der vorliegenden Erfindung, jedes planmäßige Vorgehen verstanden, welches die Erhebung von Befunden, Phänomenen oder Symptomen und/oder deren Klassifizierung zu einer Kategorie bzw. deren Interpretation umfasst. Insbesondere erfasst der Begriff ”Diagnose” die Erhebung und/oder Zuordnung von Befunden, Phänomenen oder Symptomen zu einem Krankheitsbegriff oder einer spezifischen Erkrankung.

So wie hierin verwendet, bezeichnet der Begriff ”Therapie” die Umkehrung, Linderung oder Hemmung des Fortschreitens einer Erkrankung, Störung oder eines Zustands oder eines oder mehrerer Symptome einer solchen Erkrankung, Störung oder eines solchen Zustands, auf welche dieser Begriff zutrifft. So wie hierin verwendet, kann ”Therapie” sich auch darauf beziehen, dass die Wahrscheinlichkeit oder Häufigkeit, mit der eine Erkrankung, Störung oder ein Zustand bei einem Säuger im Vergleich zu einer unbehandelten Kontrollpopulation oder im Vergleich zum gleichen Säuger vor der Behandlung auftritt, verringert wird. So wie hierin verwendet, kann ”Therapie” sich beispielsweise auch auf die Prävention einer Erkrankung, Störung oder eines Zustands beziehen und kann auch die Verzögerung oder Verhütung des Beginns einer Erkrankung, Störung oder eines Zustands oder die Verzögerung oder Verhütung der mit einer Erkrankung, Störung oder eines Zustands verbundenen Symptome umfassen. So wie hierin verwendet, kann ”Therapie” sich auch darauf beziehen, dass die Schwere einer Erkrankung, Störung oder eines Zustands oder von Symptomen, die mit einer solchen Erkrankung, Störung oder eines solchen Zustands verbunden sind, verringert wird, ehe der Säuger von der Erkrankung, Störung oder dem Zustand befallen wird. Eine solche Prävention oder Verringerung der Schwere einer Erkrankung, Störung oder eines Zustands vor dem Befallensein betrifft die Verabreichung der Zusammensetzung der vorliegenden Erfindung – wie hierin beschrieben – an ein Individuum, das zum Zeitpunkt der Verabreichung nicht von der Erkrankung, Störung oder dem Zustand befallen ist. So wie hierin verwendet, kann ”Therapie” sich auch darauf beziehen, dass das Wiederauftreten einer Erkrankung, Störung oder eines Zustands oder eines oder mehrerer mit einer solchen Erkrankung, Störung oder einem solchen Zustands verbundenen Symptome verhindert wird. So wie hierin verwendet, bezieht sich der Begriff ”therapeutisch” auf den Akt des Behandelns im Sinne der obigen Definition von ”Therapie”.

Die vorliegende Erfindung bezieht sich auch auf ein Verfahren zur Diagnose oder Therapie von Erkrankungen, die mit einer Veränderung im Tau-Proteinspiegel einhergehen, insbesondere von Hirninfarkt, Schlaganfall, Creutzfeld-Jakob-Erkrankung, Taupathien, Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und/oder progressive supranukleäre Blickparese, wobei einem Patienten, der einer solchen Diagnose oder Therapie bedarf, eine wirksame Dosis des erfindungsgemäßen Aptamers oder der erfindungsgemäßen pharmazeutischen Zusammensetzung verabreicht wird.

Gemäß vorliegender Erfindung wird das erfindungsgemäße Aptamer bzw. die erfindungsgemäße pharmazeutische Zusammensetzung vorzugsweise in einer wirksamen Dosis verabreicht. Eine ”wirksame Dosis” ist die Dosis, die bei Verabreichung an einen Patienten eine messbare therapeutische Wirkung im Hinblick auf die fragliche Krankheit bewirkt.

Die Erfindung bezieht sich ferner auf ein Verfahren zur Aufreinigung von humanem Tau-Protein oder Fragmenten davon, dadurch gekennzeichnet, dass eine Probe, die humanes Tau-Protein oder ein Fragment davon enthält, mit mindestens einem erfindungsgemäßen Aptamer kontaktiert wird, und der Komplex aus Aptamer und humanem Tau-Protein oder einem Fragment davon von der restlichen Probe abgetrennt wird. Ggf kann in einem weiteren, optionalen Schritt der Komplex in das humane Tau-Protein oder das gebundene Fragment davon und das erfindungsgemäße Aptamer gespalten werden, so dass Aptamer und humanes Tau-Protein (bzw. das Fragment davon) voneinander separiert werden können.

Eine Probe im Sinne der Erfindung ist ein bereitgestelltes oder durch Probenentnahme erhaltenes biologisches oder chemisches Material oder ein Teil bzw. eine kleine Menge eines solchen Materials, von dem angenommen wird, dass es humanes Tau-Protein oder ein Fragment davon umfasst, oder dessen Beschaffenheit chemisch, biologisch, klinisch oder ähnlich geprüft werden soll auf das Vorhandensein von humanem Tau-Protein oder einem Fragment davon. Eine Probe können insbesondere alle biologischen Materialien sein, die von Individuen isoliert worden sind, beispielsweise biologische Gewebe und Flüssigkeiten, zu denen u. a. Blut, Haut, Plasma, Serum, Lymphe, Urin, Gehirnflüssigkeit, CSF, Tränen, Abstriche, Gewebeproben, Organe und Tumore zählen. Vorliegend sind in Proben auch Bestandteile von Zellkulturen eingeschlossen. Die Probenentnahme erfolgt beispielsweise derart, dass die entnommene Teilmenge einem repräsentativen Durchschnitt der gesamten Menge entspricht. Die durch Untersuchung der Probe ermittelten Merkmale dienen der Beurteilung der durch die Probe erfassten Menge, die wiederum Rückschlüsse auf die Gesamtmenge, beispielsweise das Blut bzw. die Lymphe in einem Organismus, zulässt. Für die Untersuchung können die Proben vorbehandelt, wie z. B. durch Mischen, Zugabe von Enzymen oder Markern, oder aufgereinigt werden.

Die Probe wird mit mindestens einem der erfindungsgemäßen Aptamere kontaktiert. Unter einer Kontaktierung im Sinne der Erfindung kann beispielsweise eine Inkubation der Probe und der darin enthaltenen Verbindungen mit einem erfindungsgemäßen Aptamer verstanden werden. Dabei ist es möglich die Zugänglichkeit von Verbindungen in der Probe z. B. durch chemische Lösungen und/oder physikalische Methoden, wie z. B. Erhitzen, zu verbessern.

Nach einer Inkubationszeit werden die spezifischen Produkte, d. h. die Komplexe aus Aptamer und humanem Tau-Protein oder einem Fragment davon, von der restlichen Probenlösung abgetrennt. Geeignete Methoden sind dem Fachmann bekannt, wie z. B. Dialyse, Ultrafiltration, Gelfiltration, Fällung, Chromatographie, magnetische Trennung oder einfach Waschschritte. Der Komplex kann dabei immobilisiert vorliegen.

Durch Veränderungen der für die Aptamerbindung erforderlichen definierten Bedingungen kann in einem weiteren, optionalen Schritt der Komplex getrennt werden. Hierzu können physiko-chemische Einwirkungen, wie z. B. eine Variation von Salzkonzentration oder pH oder eine hitzebedingte Denaturierung, angewendet werden. Abschließend ist eine weitere Reinigung der Verbindung möglich, wobei das Aptamer zuvor abgebaut werden kann, z. B. durch saure (thermische) Hydrolyse oder DNasen. Sofern das Aptamer immobilisiert ist, kann die aufgereinigte Verbindung eluiert werden, wie z. B. von einer Säule, die anschließend regeneriert und wiederverwendet wird.

Erfindungsgemäß können die Aptamere auch an einer festen Phase immobilisiert vorliegen, vorzugsweise über ein Spacer-Molekül, das beispielsweise eine Linker-Nukleinsäure umfassen kann. Geeignete Methoden der Immobilisierung sind dem Fachmann bekannt, die sowohl mit einer kovalenten Kopplung als auch einer nicht-kovalenten Kopplung mittels geeigneter Affinitätspaare, wie z. B. Biotin/Streptavidin, einhergehen können. Die feste Phase können beispielsweise Platten, Streifen, Membranen, Filme, Gele oder Perlen sein. Geeignete Trägermaterialien sind anorganische und organische Polymere. Hierzu zählen Kunststoffe, vorzugsweise auf Basis von Polystyrol. Des weiteren sind Biopolymere, vorzugsweise Cellulose, Dextran, Agar, Agarose und Sephadex, die funktionalisiert sein können, insbesondere als Nitrocellulose oder Cyanbromid-Sephadex, Polymere im erfindungsgemäßen Verfahren. Aptamere können an Magnetic Beads gebunden werden, die z. B. Carboxy-terminierte, Amino-terminierte, Tosyl-aktivierte oder Epoxy-aktivierte Seitenketten tragen. Des Weiteren ist eine Kopplung von Magnetic Beads an die Desoxyribose der Aptamere möglich. Die Beispiele für Polymere sind nicht limitierend und andere Moleküle denkbar. Bevorzugte Kombinationen von geometrischer Form und Material sind Gele aus Biopolymeren, insbesondere Agarose, und Gelmatrices aus Dextran und Sephadex, die – beispielsweise in Säulen verpackt – Hohlräume definierter Porengröße ausbilden.

Die Erfindung betrifft auch ein Verfahren zum Nachweis von humanem Tau-Protein oder Fragmenten davon, dadurch gekennzeichnet, dass die zu untersuchende Probe mit mindestens einem erfindungsgemäßen Aptamer inkubiert und ein Bindungsereignis zwischen dem Aptamer und humanem Tau-Protein oder einem Fragment davon nachgewiesen wird.

Die Probe und das Aptamer werden gemäß der vorherigen Lehre dieser Erfindung gewonnen, vorbereitet, wie z. B. immobilisiert, und inkubiert, im Ergebnis dessen das Aptamer und ein in der Probe vorhandenes Tau-Protein oder ein Fragment davon einen Komplex bilden. Das Bindungsereignis kann beispielsweise elektrochemisch, optisch, mikrogravimetrisch, kalorimetrisch oder piezoelektrisch nachgewiesen werden. Bei einem markierungsfreien Nachweis kann das Aptamer beispielsweise auf einer Oberfläche fixiert werden und die Änderung der Schichtdicke nach Anlagerung der Tau-Proteine oder der Fragmente davon mit einer der genannten Methoden bestimmt werden, wie z. B. optisch über eine Änderung des Evaneszenz-Feldes. Meist ist die Komplexierung nicht direkt detektierbar und wird vorzugsweise in einer Indikatorreaktion nach einer direkten oder indirekten Kopplung eines Komplexpartners mit einer gut nachweisbaren Markierungssubstanz sichtbar gemacht. Das bedeutet, entweder ist das verwendete Aptamer oder das Tau-Protein bzw. das Fragment davon mit einer Markierung versehen. Bevorzugt ist das Aptamer markiert.

In einer Ausgestaltung des Verfahrens der Erfindung kann die Markierung durch Lumineszenz, UV/VIS-Farbgebung, enzymatisch, elektrochemisch oder radioaktiv erfolgen. Lumineszenz betrifft die Emission von Licht. Im erfindungsgemäßen Verfahren finden vorzugsweise die Photolumineszenz, die Chemilumineszenz und die Biolumineszenz zum Nachweis der Markierung Anwendung. Bei der Photolumineszenz oder Fluoreszenz erfolgt die Anregung durch Absorption von Photonen. Bevorzugte Fluorophore sind Bisbenzimidazole, die kovalent an Aptamere oder Nachweisreagenzien auf DNA-Basis gekoppelt werden, Fluorescein, Acridinorange, Cy5, Cy3 oder Propidiumiodid. Die Auswertung geschieht visuell oder mit entsprechenden Messgeräten, z. B. im Fluoreszenzmikroskop oder Fluorimeter, oder durch Durchflusscytometrie, z. B. im Cytofluorimeter. Chemilumineszenz beschreibt die Emission sichtbaren Lichts als Folge einer chemischen Reaktion. Eine bevorzugte chemische Markierung zur Chemilumineszenz ist Luminol, das nach Oxidation, wie z. B. mit H2O2, eine intensive blaue Chemilumineszenz zeigt. Biolumineszenz beinhaltet die Emission sichtbaren Lichts als Folge einer durch das Enzym Luciferase katalysierten Redoxreaktion.

Darüber hinaus kann der Nachweis mit weiteren Enzymen als Markierungssubstanzen geführt werden, die Substrate zu farbigen Produkten umsetzen, vorzugsweise Peroxidase, Chloramphenicol Acetyltransferase (CAT), GFP (sog. ”green fluorescent protein”), Glutathion-S-Transferase (GST), Luciferase, β-Galactosidase oder Alkalische Phosphatase. Beispielsweise wird das farblose Substrat X-Gal durch die Aktivität der β-Galactosidase zu einem blauen Produkt umgesetzt, dessen Farbgebung visuell erfasst werden kann. Die Alkalische Phosphatase (AP) setzt 5-Brom-4-Chlor-3-Indolylphosphat (BCIP oder X-Phosphat) und Nitroblau-Tetrazoliumsalz (NBT) farbig um. Die Farbstoffe fallen dabei in unmittelbarer Nähe der AP-Moleküle aus und färben die Umgebung der gebundenen Verbindungen dunkelviolett an. Die Peroxidase katalysiert z. B. die Oxidation von ABTS (2,2'-Azino-bis-[3-ethylbenzthiazolin-6-sulfonsäure]) in Gegenwart von H2O2. Aufgrund der Enzymstabilität und einer Vielzahl an möglichen Substraten ist die Meerrettich-Peroxidase bevorzugt.

In Enzymelektroden wirken immobilisierte Enzyme als Rezeptor und ein elektrochemisches Messsystem fungiert als Transduktor. Im Sinne der vorliegenden Erfindung können die Enzyme sowohl auf Aptameren oder Nachweisreagenzien für die Inkubationskomplexe, oder auf einem externen Träger immobilisiert sein. Die Enzyme liefern durch Bildung oder Abbau elektrodenaktiver Substrate ein direktes chemisches Signal, das vom Transduktor in ein elektrisches Signal umgewandelt wird. Die Substrate befinden sich konträr zu den immobilisierten Enzymen an einem externen Träger, oder sind kovalent an Aptamere der vorliegenden Erfindung oder Nachweisreagenzien der Komplexe gekoppelt. Bevorzugte Systeme basieren auf spezifischen Oxidasen, wie z. B. der Glucoseoxidase, wobei Coenzyme über Redoxmediatoren die Verknüpfung mit elektrochemischen oder optischen Sensorelementen gewährleisten.

Alternativ kann der Nachweis auch radioaktiv mit radioaktiven Isotopen erfolgen, vorzugsweise 3H, 14C, 32P, 33P, 35S oder 125I, besonders bevorzugt 32P, 33P oder 125I. Bei der Sintillationszählung wird z. B. ein Molekülcocktail durch radioaktive β-Strahlung angeregt. Die beim Übergang in den Grundzustand als Licht freigesetzte Energie wird durch einen Photoelektronenvervielfacher verstärkt und gezählt.

Die Aptamere können auch mit Digoxigenin oder Biotin markiert sein, die beispielsweise durch Antikörper oder Streptavidin gebunden werden, die wiederum eine Markierung tragen können, wie z. B. ein Enzymkonjugat. Ist das Aptamer an ein Enzym gekoppelt, spricht man vom ELONA (enzyme-linked oligonucleotide assay). Die vorherige kovalente Verknüpfung (Konjugation) eines Aptamers mit einem Enzym kann auf verschiedene bekannte Arten erfolgen. Der Nachweis der Aptamer-Bindung kann auch radioaktiv in einem dem RIA (radioactive immunoassay) entsprechenden Assay mit radioaktiven Isotopen, vorzugsweise mit 125I, oder durch Fluoreszenz in einem dem FIA (Fluoroimmunoassay) entsprechenden Assay mit Fluorophoren, vorzugsweise mit Fluorescein oder FITC, erfolgen.

Alle genannten Methoden schließen intensive Waschschritte ein, um ungebundene und/oder unspezifisch gebundene Aptamere und/oder Nachweisreagenzien abzutrennen. Die Durchführung sämtlicher Nachweisverfahren ist dem Fachmann bekannt. Der direkte Nachweis der Markierung ist im vorliegenden Verfahren der Erfindung bevorzugt, insbesondere der direkte Nachweis durch Fluoreszenz.

In einer weiteren Ausgestaltung des Verfahrens wird der Nachweis in-situ durchgeführt. Diese Umsetzung erfordert einen geeigneten Inkubationsraum, auf dem der Nachweis einfach durchgeführt und sichtbar gemacht werden kann. Hierzu wird vorteilhaft ein fester Träger verwendet, der es ermöglicht, Probe, Aptamere und ggf. Nachweisreagenzien der Komplexe zu fixieren. Die Aptamere können sowohl vor oder nach der Probe auf den festen Träger aufgebracht werden. Methoden der Immobilisierung vorgenannter Aptamere sind dem Fachmann bekannt und werden vorzugsweise nicht in-situ, sondern während oder im Anschluss an die Produktion des festen Trägers durchgeführt. Für den Nachweis kommen beispielsweise ein visueller Farbnachweis oder ein elektrochemischer Nachweis in Frage. Im Farbnachweis können die Aptamere markiert sein, so dass direkt im Anschluss an die Inkubation ein Ablesen und Auswerten realisiert werden kann.

Die Erfindung betrifft auch die Verwendung der erfindungsgemäßen Aptamere zur Aufreinigung und/oder zum Nachweis von humanem Tau-Protein oder Fragmenten davon. Das erfindungsgemäße Aptamer ist insbesondere zur Affinitätsreinigung und/oder Affinitätschromatographie geeignet. Das erfindungsgemäße Aptamer kann auch als Rezeptorelement für Biosensoren, in der klinischen Analytik, Umweltanalytik und/oder Prozessüberwachung der pharmazeutischen und chemischen Industrie vorteilhaft eingesetzt werden.

Die Erfindung lehrt des Weiteren einen Kit, der mindestens eines der erfindungsgemäßen Aptamere umfasst. Neben dem erfindungsgemäßen Aptamer kann der Kit weitere aktive Stoffe und/oder Hilfsstoffe enthalten. Der Kit kann gegebenenfalls Verbrauchsmaterialien wie z. B. Behälter, Reaktionsgefäße und/oder Küvetten enthalten, die für die Lagerung und/oder die Nachweisreaktion geeignet sind.

Im Rahmen der vorliegenden Erfindung wurden also erstmalig Aptamere bereitgestellt, die an humanes Tau-Protein bzw. Fragmente davon binden. Bei den erfindungsgemäßen Aptameren handelt es sich um Aptamere, deren Sequenzen bisher nicht beschrieben sind. Die Aptamere zeichnen sich durch eine hohe Affinität und eine ausgeprägte Spezifität für humanes Tau-Protein aus. Diese Eigenschaften bilden die Grundlage für eine zuverlässige Erkennung, womit das Fehlen von Kreuzreaktivitäten eingeschlossen ist, und einen reproduzierbaren Nachweis von humanem Tau-Protein oder Fragmenten davon. Die Affinität und Spezifität der erfindungsgemäßen Aptamere ist damit grundsätzlich mit denen von Antikörpern vergleichbar oder sogar besser. Die erfindungsgemäß zur Verfügung gestellten Aptamere können kostengünstig in-vitro hergestellt werden. Im Vergleich zur Antikörpertechnologie beispielsweise werden keine Versuchstiere für Immunisierungszwecke benötigt. Die Aptamere auf DNA-Basis besitzen auch eine hohe Stabilität und sind nicht zuletzt aufgrund ihrer geringen Größe gut zu handhaben.

Die erfindungsgemäßen Aptamere können einzeln oder in Mischungen enthaltend mehrere verschiedene erfindungsgemäße Aptamere verwendet werden.

Die erfindungsgemäßen Aptamere können auch in Kombination mit anderen Substanzen verwendet werden, die spezifisch an Zielstrukturen binden können, wie z. B. andere Aptamere oder Antikörper. Solche Kombinationen können in Assays zum Nachweis von Zielstrukturen zum Einsatz kommen, beispielsweise in Form von sogenannten ”sandwich”-Assays bei denen ein spezifischer Binder dazu dient die Zielstruktur zu isolieren und der zweite Binder zum Nachweis von isolierten Zielstrukturen verwendet wird. Solche Assays können beispielsweise als ELISA, ELONA, RIA oder Streifen-Assays ausgebildet sein, wobei das erfindungsgemäße Aptamer gegebenenfalls an einem festen Träger immobilisiert vorliegen kann.

Die erfindungsgemäßen Aptamere können insbesondere in der Differentialdiagnostik der oben genannten Erkrankungen, bevorzugt in der Differentialdiagnostik der Creutzfeldt-Jakob-Erkrankung und/oder Alzheimer eingesetzt werden. Bei der Creutzfeldt-Jakob-Erkrankung wurde beobachtet, dass im Liquor das Gesamt-Tau-Protein höher ist als das Phospho-Tau. Bei Alzheimer wurde ein erhöhter Tau-Protein-Spiegel und erniedrigter Aβ42-Spiegel in CSF gefunden. Der Quotient Tau/Aβ42 kündigt schon bei asymptomatischen Probanden eine zukünftige Demenz-Erkrankung an.

Die erfindungsgemäßen Aptamere können auch gemeinsam mit Antikörpern eingesetzt werden. Beispielsweise zur Differentialdiagnostik, wobei für verschiedene Formen/Fragmente der nachzuweisenden Zielstrukturen entweder Aptamere oder Antikörper verwendet werden. Ebenso können erfindungsgemäße Aptamere und Antikörper in Sandwich-Assays kombiniert werden. Dann sind ein Aptamer und ein Antikörper in der Lage, gleichzeitig an ein Zielmolekül (Tau Protein oder Fragment) zu binden. Beispielsweise dient das (immobilisierte) Aptamer dazu, das Zielmolekül zu binden, und der Antikörper trägt eine Markierung, so dass nach seiner Bindung an das Zielmolekül ein Signal erzeugt wird. Ebenso ist es möglich, den Antikörper zur Zielmolekül-Bindung und das Aptamer für den Nachweis zu nutzen.

Im Folgenden wird die Erfindung anhand von Ausführungsbeispielen näher erläutert.

Figuren:

1. zeigt schematisch den Aufbau der verwendeten synthetischen single stranded (ss) DNA-Bibliothek.

2. zeigt den SELEX-Verlauf zur Selektion von DNA-Aptameren, spezifisch für das Tau-Peptid Tau226-240. Darstellung der Menge an targetgebundener ssDNA, eluiert von den entsprechenden Tau-modifizierten Streptavidin-Magnetic Beads im Target-Selektionsschritt jeder SELEX-Runde. Außerdem wurde ein Negativ-Selektionsschritt in jeder Runde durchgeführt und zusätzlich ein Subtraktionsschritt in Runde 10, 11 und 12.

3. zeigt vergleichende Bindungsversuche mit ausgewählten Aptamer-Klonen.

4. zeigt die Sättigungskurve von Aptamer-Klon #5/60.

Ausführungsbeispiele:

Die Tau-spezifischen Aptamere wurden unter Anwendung des FluMag-SELEX-Prozesses, einer in vitro Selektions- und Amplifikationsmethode, selektiert. Der FluMag-SELEX-Prozess ist ein fluoreszenzkontrollierter Selektionsprozess zur Gewinnung von ssDNA Aptameren für ein spezifisches Target. Die Targetmoleküle werden dabei auf Magnetic Beads, verfügbar mit verschieden funktionalisierten Oberflächen, immobilisiert. Der FluMag-SELEX-Prozesses ist beschrieben in Stoltenburg et al., ”FluMag-SELEX as an advantageous method for DNA aptamer selection”, Anal Bioanal Chem. 2005; 383(1): 83–91.

Ausgangspunkt des FluMag-SELEX-Prozesses ist im vorliegenden Fall eine synthetische ssDNA-Bibliothek, deren Aufbau in 1 dargestellt ist und deren Oligonukleotide jeweils eine Länge von 76 nt besitzen. Diese sind außerdem durch eine innere Region von 40 nt mit variabler Nukleotidabfolge charakterisiert, welche von zwei unterschiedlich definierten, konstanten Sequenzen (Primerbindungsorte) flankiert wird. Die ssDNA-Bibliothek stellt somit einen komplexen Pool von ca. 1015 verschiedenen Oligonukleotiden dar, der in der ersten SELEX-Runde direkt zum Einsatz kommt, und aus dem über weitere, aufeinanderfolgende SELEX-Runden diejenigen Oligonukleotide (Aptamere) selektiert und angereichert werden, die besonders gut an das vorgegebene Zielmolekül (z. B. Tau-Peptid) binden.

Eine SELEX-Runde besteht im Wesentlichen aus 5 Schritten. Zu Beginn einer Runde werden die Oligonukleotide in Bindungspuffer (100 mM NaCl, 20 mM Tris/HCl, pH 7.6, 2 mM MgCl2, 5 mM KCl, 1 mM CaCl2, 0,02% Tween20) zunächst thermisch equilibriert (90°C 8 min, Eis 10 min, RT 3–6 min). Anschließend werden die Oligonukleotide sofort in einer Bindungsreaktion (Target-Selektionsschritt) zusammen mit dem Target, immobilisiert auf Magnetic Beads, inkubiert (21°C, 30 min, schütteln). Alle Oligonukleotide, welche nicht an das Target gebunden haben, werden dann in mehreren Waschschritten (Bindungspuffer) entfernt. Durch die Nutzung von Magnetic Beads zur Targetimmobilisierung sind eine effiziente Trennung der entstandenen Bindungskomplexe von den ungebundenen Oligonukleotiden sowie stringente Waschbedingungen möglich. Danach erfolgt die Elution der an das Target gebundenen Oligonukleotide durch eine Hitzebehandlung (in Bindungspuffer, 80°C, 2 × 7 min). Der nächste Schritt umfaßt die Amplifikation der gesamten eluierten ssDNA mittels PCR. Dabei werden durch die Wahl 5'-modifizierter Primer einerseits eine Fluorescein-Markierung an den relevanten DNA-Strang angefügt und andererseits der Gegenstrang durch einen HEGL-Spacer + zusätzliche Nukleotide (dA20) verlängert. Diese Einführung eines Längenunterschiedes zwischen beiden DNA-Strängen während der PCR ermöglicht im Anschluß eine Reinigung der relevanten, nunmehr Fluorescein-markierten ssDNA aus den dsDNA-PCR-Produkten über eine denaturierende PAGE. Auf diese Weise wird ein neuer, nun bereits selektierter Oligonukleotid-Pool generiert, welcher in der nächsten SELEX-Runde mit frischen Target-modifizierten Magnetic Beads zur Bindung gebracht wird. Die Fluorescein-Markierung der Oligonukleotide ermöglicht ab der 2. SELEX-Runde die Quantifizierung der ssDNA in den einzelnen Schritten jeder Runde. Durch das Einführen zusätzlicher Schritte in eine SELEX-Runde kann zusätzlich Einfluß auf die Spezifität der zu selektierenden Aptamere genommen werden. Ein Negativ-Selektionsschritt kann der eigentlichen Bindungsreaktion vorgeschaltet werden. D. h. der Oligonukleotid-Pool wird beispielsweise mit unmodifizierten Magnetic Beads oder mit solchen, die dem Target verwandte Moleküle tragen, an die die Aptamere nicht binden sollen, inkubiert (21°C, 30 min, schütteln), um diejenigen (unerwünschten) Oligonukleotide herauszusortieren, die an Oberflächen oder Moleküle binden, die nicht das Target sind. Alle hierbei nicht-bindenden Oligonukleotide werden dann direkt in die eigentliche Bindungsreaktion mit dem Selektionstarget gegeben. Darüberhinaus kann ein Subtraktionsschritt nach der Elution Target-gebundener Oligonukleotide eingefügt werden. D. h. der selektierte Oligonukleotid-Pool einer SELEX-Runde wird nochmals mit entsprechenden Magnetic Beads (siehe Negativ-Selektionsschritt) inkubiert (21°C, 30 min, schütteln), um alle unerwünscht-bindenden Oligonukleotide zu entfernen. Die hierbei nicht-bindenden Oligonukleotide werden anschließend für die nächste SELEX-Runde aufgearbeitet (Amplifikation, Reinigung).

Im vorliegenden Fall, der Selektion Tau-Peptid-spezifischer Aptamere, kamen zwei Varianten eines Tau-Peptids als Target zum Einsatz: Tau226-240 (SEQ ID No. 1) und die doppeltphosphorylierte Variante Tau226–240(2P). Die Peptide entsprechen der Aminosäureposition 226–240 des humanen Tau-Proteins Isoform Tau-441 (Tau-F). Bei der phosphorylierten Variante wurde Threonin an Position 231 und Serin an Position 235 phosphoryliert. Beide Peptide bestehen aus 15 As und wurden am N-Terminus mit Biotin über einen Aminohexansäure-Spacer gekoppelt. Dies ermöglichte die Immobilisierung der Peptide an Streptavidin-Magnetic Beads (Tau226-StrepBeads bzw. Tau226(2P)-StrepBeads). Die Runden 1–7 wurden unter Verwendung von Tau226(2P)-StrepBeads (je 1 × 108 Beads) durchgeführt, in den Runden 8–13 kamen Tau226-StrepBeads (je 1 × 108 Beads) zur Anwendung. Darüberhinaus wurden spezielle Beads im Neagtiv-Selektionsschritt bzw. Subtraktionsschritt eingesetzt, um unspezifisch bindende Oligonukleotide zu entfernen.

In jeder SELEX-Runde wurden zunächst ein Negativ-Selektionsschritt und anschließend der eigentliche Target-Selektionsschritt durchgeführt. Die an die jeweils verwendeten Magnetic Beads gebundenen Oligonukleotide wurden nach mehreren Waschschritten durch eine Hitzebehandlung der Bindungskomplexe wieder von den Magnetic Beads eluiert und ab der 2. SELEX-Runde quantifiziert (Fluoreszenzmessung). Die Menge der eluierten Oligonukleotide aus jeder SELEX-Runde diente als Kriterium zur Bewertung des Selektionsverlaufes und ist in einem Säulendiagramm in 2 dargestellt.

In den ersten sechs Runden wurde der SELEX-Prozess auf die doppeltphosphorylierte Peptidvariante Tau226–240(2P), immobilisiert auf Streptavidin-Magnetic Beads, als Zielmolekül für die Aptamerselektion ausgerichtet. Im Negativ-Selektionsschritt wurden die unmodifizierten Beads verwendet. Dadurch konnte eine Anreicherung unspezifisch bindender Oligonukleotide verhindert werden. Die Ergebnisse zeigten aber auch, dass keine Oligonukleotide für das doppeltphosphorylierte Peptid Tau226–240(2P) angereichert werden konnten. Daraufhin wurden zur Kontrolle in Runde 7 die unmodifizierten Beads im Negativ-Selektionsschritt durch die Tau226-StrepBeads (unphosphorylierte Peptidvariante Tau226-240) ersetzt. Eine signifikante Menge ssDNA band an die Tau226-StrepBeads (Balken in Runde 7 im Säulendiagramm 2). Damit zeigte sich, dass in den 6 SELEX-Runden überraschenderweise ein Oligonukleotid-Pool selektiert wurde, der an das unphosphorylierte Tau-Peptid binden kann, nicht jedoch an die phosphorylierte Variante. Wahrscheinlich waren gleichzeitig auch unphosphorylierte Varianten der Zielmoleküle, wenn auch in sehr geringer Menge, vorhanden. Überraschenderweise haben sich hierfür spezifisch bindende Oligonukleotide im Selektionsverlauf durchgesetzt. Nachdem dies erkannt worden war, wurde ab Runde 8 ein Targetwechsel vollzogen und der SELEX-Prozess auf die Selektion von Aptameren für das unphosphorylierte Tau-Peptid Tau226-240 ausgerichtet. In den folgenden sechs Runden konnte der Oligonukleotid-Pool weiter spezifiziert werden (siehe 2). Ab Runde 10 wurden im Negativ-Selektionsschritt weitere Beads mit unspezifischen Oberflächen verwendet. Zusätzlich wurde in den Runden 10, 11 und 12 ein Subtraktionsschritt, ebenfalls mit diesen unspezifischen Beads, eingeführt. Beide Maßnahmen dienten der Entfernung solcher Oligonukleotide aus dem selektierten Pool, die unspezifische Bindungen aufweisen. Nach der 13. SELEX-Runde wurde der SELEX-Prozess beendet und der selektierte Oligonukleotid-Pool anschließend kloniert. Insgesamt wurden 47 individuelle Aptamer-Klone charakterisiert. Nach Sequenzierung und Sequenzanalyse konnten diese 47 Aptamere aufgrund von Sequenzhomologien in 8 Gruppen eingeteilt werden, siehe Tabelle 1. Herausragend war die Gruppe 1. Sie enthielt mit 29 Aptamer-Klonen die meisten Vertreter. Die anderen Gruppen enthielten 3–6 Vertreter oder stellten Einzelklone dar. Eine gruppenübergreifende Konsensussequenz konnte nicht identifiziert werden. In der Gruppe 2 wurden alle Aptamer-Klone zusammengefasst, die intern vollständige bzw. teilweise Wiederholungen der 3'-Primerbindungsregion enthalten. Da die Primerbindungsregionen in allen Aptameren methodisch-bedingt vorhanden sind, könnten die Aptamere der Gruppe 2 möglicherweise PCR-Artefakte darstellen.

Bindungsstudien mit individuellen Aptameren

Erste vergleichende Bindungsstudien mit einzelnen Aptamer-Klonen wurden entsprechend den SELEX-Bedingungen durchgeführt. In einer Bindungsreaktion wurden Tau226-StrepBeads (je 1 × 107) und Fluorescein-markierte ssDNA eines Aptamer-Klones (13–16 pmol, nach thermischer Equilibrierung) zusammengegeben und inkubiert (21°C, 30 min, schütteln; Bindungspuffer). Anschließend erfolgten mehrere Waschschritte, um alle ungebundenen Aptamere zu entfernen. Die Target-gebundenen Aptamere wurden durch eine Hitzebehandlung (in Bindungspuffer, 80°C, 2 × 7 min) wieder von den Tau226-StrepBeads eluiert. Durch die Fluoresceinmarkierung der ssDNA konnten die Aptamere im Eluat gemessen und über eine Eichkurve quantifiziert werden. Die Ergebnisse sind in einem Säulendiagramm in 3 dargestellt.

Für die vergleichenden Bindungsstudien wurde je ein Vertreter der 8 Aptamer-Gruppen eingesetzt, außerdem der selektierte Aptamer-Pool und die unselektierte ssDNA-Bibliothek. Der selektierte Aptamer-Pool zeigte erwartungsgemäß das höchste Bindungsvermögen, während das Bindungsverhalten der einzelnen Aptamer-Klone sehr unterschiedlich ausfiel. Die Klone #1/2 (Gr. 2), #11/44 (Gr. 3) und #11/42 (Gr. 7) zeigten ein geringes Bindungsvermögen. Die Klone #11/34 (Cr. 1) und #3/21 (Cr. 6) waren in ihrem Bindungsvermögen etwa vergleichbar mit der unselektierten ssDNA-Bibliothek. Ein besseres Bindungsvermögen zeigten die Klone #3/22 (Cr. 4), #1/5 (Gr. 5) und insbesondere #5/60 (Gr. 8).

Vom Aptamer-Klon #5/60, als bester Binder gemäß der bisherigen Bindungstudien, wurde eine Sättigungskurve aufgenommen und der KD-Wert als ein Maß für die Affinität des Aptamers zu seinem Target bestimmt, siehe 4. In mehreren Bindungsansätzen wurde die Aptamer-DNA in aufsteigender Konzentration (in einem Bereich von 5–200 pmol/ml) mit Tau226-StrepBeads (konstante Beadzahl von 1 × 107) zur Bindung zusammengegeben. Die Versuchsbedingungen entsprachen denen der oben beschriebenen vergleichenden Bindungsstudien. Über eine Nichtlineare Regressionsanalyse der Bindungsdaten konnte ein KD-Wert von 76 nM (±9,6 nM) für das Aptamer #5/60 ermittelt werden.

Es folgt ein Sequenzprotokoll nach WIPO St. 25.Dieses kann von der amtlichen Veröffentlichungsplattform des DPMA heruntergeladen werden.

ZITATE ENTHALTEN IN DER BESCHREIBUNG

Diese Liste der vom Anmelder aufgeführten Dokumente wurde automatisiert erzeugt und ist ausschließlich zur besseren Information des Lesers aufgenommen. Die Liste ist nicht Bestandteil der deutschen Patent- bzw. Gebrauchsmusteranmeldung. Das DPMA übernimmt keinerlei Haftung für etwaige Fehler oder Auslassungen.

Zitierte Nicht-Patentliteratur

  • K. Bracht in ”Indikatoren für Diagnose und Therapie”; Pharmazeutische Zeitung online Ausgabe 12/2009; http://www.pharmazeutische-zeitung.de/index.php?id=29346&type=0 [0003]
  • Hort et al., ”Bedeutung der Gesamt-Tau und Phospho-Tau-Protein-Liquorspiegel in der Demenzdiagnostik”, Nervenarzt 2008, 79, 891–898 [0006]
  • http://blast.ncbi.nlm.nih.gov/Blast.cgi [0028]
  • Tuerk & Gold, Science 249 (1990) 505–510, sowie Ellington & Szostak, Nature 346 (1990) 818–822 [0029]
  • Stoltenburg et al., ”FluMag-SELEX as an advantageous method for DNA aptamer selection”, Anal Bioanal Chem. 2005; 383(1): 83–91 [0076]