Title:
New aptamer that specifically binds to human tau protein or its fragment, useful e.g. in vitro for isolating, purifying and/or detecting tau protein, and to treat cerebral infarction, pick disease and/or progressive supranuclear palsy
Kind Code:
A1
Abstract:
Aptamer that specifically binds to human tau protein or its fragment, is new. Independent claims are included for: (1) kit comprising the aptamer; (2) a method for the purification of human tau protein or its fragments comprising contacting a sample containing human tau protein or its fragments with the aptamer and separating the obtained complex of aptamer and bound tau protein or its fragments from the remaining sample; and (3) a method for detection of human tau protein or its fragments comprising contacting a sample to be tested with the aptamer and detecting a binding event between the aptamer and the human tau protein or its fragment. ACTIVITY : Cerebroprotective; Vasotropic; Neuroprotective; Nootropic; Antiparkinsonian. MECHANISM OF ACTION : None given.


Inventors:
Stoltenburg, Regina, Dr. (04157, Leipzig, DE)
Strehlitz, Beate, Dr. (04279, Leipzig, DE)
Reinemann, Christine, Dr. (04275, Leipzig, DE)
Application Number:
DE102010038842A
Publication Date:
02/09/2012
Filing Date:
08/03/2010
Assignee:
Helmholtz-Zentrum für Umweltforschung GmbH - UFZ, 04318 (DE)
Other References:
Brandt R, Lee G.: Functional organization of microtubule-associated protein tau. Identification of regions which affect microtubule growth, nucleation, and bundle formation in vitro. In: J Biol Chem., 268(5), 1993 Feb 15, 3414-9.
Krylova SM, Musheev M, Nutiu R, Li Y, Lee G, Krylov SN.: Tau protein binds single-stranded DNA sequence specifically--the proof obtained in vitro with non-equilibrium capillary electrophoresis of equilibrium mixtures.. In: FEBS Lett., 579(6), 2005 Feb 28; Epub 2005 Jan 28, 1371-5.
Lee G, Rook SL.: Expression of tau protein in non-neuronal cells: microtubule binding and stabilization. In: J Cell Sci., 102 ( Pt 2), 1992 Jun, 227-37.
Stoltenburg R, Reinemann C, Strehlitz B.: FluMag-SELEX as an advantageous method for DNA aptamer selection. In: Anal Bioanal Chem., 383(1), 2005 Sep; Epub 2005 Oct 19, 83-91.
Wikipedia Artikel "Aptamer" (Version vom 20.7.2010; http://de.wikipedia.org/w/index.php?title=Aptamer&oldid=76866868)
Attorney, Agent or Firm:
Anwaltskanzlei Gulde Hengelhaupt Ziebig & Schneider, 10179, Berlin, DE
Claims:
1. Aptamer, welches spezifisch an humanes Tau-Protein oder ein Fragment davon bindet.

2. Aptamer nach Anspruch 1, dadurch gekennzeichnet, dass das Aptamer mindestens eine der folgenden Nukleins?uresequenzen umfasst oder daraus besteht:
a) eine Sequenz mit einer der SEQ ID Nrs 2 bis 27; oder
b) eine Sequenz, die zu mindestens 80% identisch ist mit einer Sequenz aus a) ?ber eine Abfolge von mindestens 18 aufeinanderfolgenden Nukleotiden.

3. Aptamer nach Anspruch 2, dadurch gekennzeichnet, dass die Sequenz in a) ausgew?hlt ist aus SEQ ID Nrs 2 bis 14.

4. Aptamer nach einem der Anspr?che 2 oder 3, dadurch gekennzeichnet, dass die Sequenz in a) ausgew?hlt ist aus SEQ ID Nrs 2, 10, 11, 12 und/oder 14.

5. Aptamer nach Anspruch 2, dadurch gekennzeichnet, dass die Sequenz in a) ausgew?hlt ist aus SEQ ID Nrs 15 bis 27.

6. Aptamer nach einem der vorhergehenden Anspr?che, dadurch gekennzeichnet, dass es sich um ein DNA-Aptamer handelt.

7. Aptamer nach einem der vorhergehenden Anspr?che, dadurch gekennzeichnet, dass die Nukleins?ure des Aptamers an ein Tr?germolek?l und/oder ein Reportermolek?l konjugiert vorliegt und/oder zus?tzliche Nukleotidsequenzen enth?lt.

8. Aptamer nach einem der vorhergehenden Anspr?che, dadurch gekennzeichnet, dass das Aptamer an humanem Tau-Protein mit der SEQ ID Nr. 1 eine KD aufweist von nicht mehr als 500 nM.

9. Pharmazeutische Zusammensetzung, dadurch gekennzeichnet, dass die pharmazeutische Zusammensetzung ein Aptamer nach einem der Anspr?che 1 bis 8 enth?lt und mindestens einen pharmazeutisch annehmbaren Hilfsstoff.

10. Kit umfassend ein Aptamer nach einem der Anspr?che 1 bis 8.

11. Aptamer nach einem der Anspr?che 1 bis 8, pharmazeutische Zusammensetzung nach Anspruch 9 oder Kit nach Anspruch 10 f?r die Verwendung in der Diagnose und/oder Therapie von Erkrankungen, die mit einer Ver?nderung im Tau-Proteinspiegel einhergehen, insbesondere von Hirninfarkt, Schlaganfall, Creutzfeld-Jakob-Erkrankung, Taupathien, Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und/oder progressive supranukle?re Blickparese.

12. Verwendung eines Aptamers nach einem der Anspr?che 1 bis 8 oder einer pharmazeutischen Zusammensetzung nach Anspruch 9 zur Herstellung eines Medikaments, bevorzugt zur Herstellung eines Medikaments f?r die Diagnose von Erkrankungen, die mit einer Ver?nderung im Tau-Proteinspiegel einhergehen, insbesondere von Hirninfarkt, Schlaganfall, Creutzfeld-Jakob-Erkrankung, Taupathien, Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und/oder progressive supranukle?re Blickparese.

13. Verwendung eines Aptamers nach einem der Anspr?che 1 bis 8 in vitro f?r die Isolierung, Reinigung und/oder zum Nachweis von Tau-Protein oder Fragmenten davon.

14. Verfahren zur Aufreinigung von humanem Tau-Protein oder Fragmenten davon, dadurch gekennzeichnet, dass eine Probe, enthaltend humanes Tau-Protein oder ein Fragment davon, mit mindestens einem Aptamer nach einem der Anspr?che 1 bis 8 kontaktiert wird und der erhaltene Komplex aus Aptamer und gebundenem Tau-Protein oder dem Fragment davon von der restlichen Probe abgetrennt wird.

15. Verfahren zum Nachweis von humanem Tau-Protein oder Fragmenten davon, dadurch gekennzeichnet, dass die zu untersuchende Probe mit mindestens einem Aptamer nach einem der Anspr?che 1 bis 8 kontaktiert wird und ein Bindungsereignis zwischen dem Aptamer und humanem Tau-Protein oder einem Fragment davon nachgewiesen wird.

Description:

Bei neurodegenerativen Erkrankungen und insbesondere bei Morbus Alzheimer kommt es meist zu einer pathologischen Ver?nderung des Gehirns, lange bevor andere Krankheitssymptome auftreten. Biomarker, die solche pr?klinischen Phasen anzeigen und eine Differenzierung zwischen verschiedenen neurodegenerativen Krankheiten erlauben, sind daher f?r eine fr?hzeitige Diagnose und Therapie bedeutsam. Dadurch kann die Lebensqualit?t der Betroffenen m?glichst lange erhalten werden und die Pflegekosten f?r das Gesundheitssystem k?nnen insgesamt verringern werden.

Derzeit beruht die Diagnose bei Morbus Alzheimer auf Ged?chtnis- und Verhaltenstests sowie bildgebenden Verfahren. Ein definitiver Nachweis der Erkrankung ist erst durch Autopsie nach dem Tod des Patienten m?glich.

Wie K. Bracht in ?Indikatoren f?r Diagnose und Therapie?; Pharmazeutische Zeitung online Ausgabe 12/2009; http://www.pharmazeutische-zeitung.de/index.php?id=29346&type=0; zusammenfasst, sind in Studien bereits Liquor-Untersuchungen auf Amyloid-?42-Peptid (A?42) und Tau-Protein verf?gbar. Dabei hat sich gezeigt, dass erh?hte Tau-Protein-Spiegel mit Alzheimer-Demenz assoziiert sind.

Tau-Protein bindet normalerweise an Mikrotubulin und stabilisiert dieses. Vermutlich stammen die bei Alzheimer erh?hten Tau-Proteinspiegel in Cerebrospinalfl?ssigkeit (CSF) aus sterbenden Neuronen. Einige Gruppen erforschen eine Alzheimer-spezifische Phosphorylierung des Molek?ls. Tau-Protein wird bei Alzheimer-Patienten abnormal hyperphosphoryliert, wodurch das Gleichgewicht der Tau-Mikrotubulin-Bindung gest?rt wird. Es konnte gezeigt werden, dass humanes Tau-Protein mit bestimmten Phosphorylierungsmustern als Pr?diktor f?r die Progression einer milden kognitiven Beeintr?chtigung zur Alzheimer-Demenz verwendet werden k?nnen.

Der Quotient Tau/A?42, gemessen in CSF, hat in Studien die derzeit beste pr?diktive Aussagekraft f?r eine zuk?nftige Demenzerkrankung bei asymptomatischen Probanden.

Neben Morbus Alzheimer ist eine Ver?nderung im Tau-Proteinspiegel auch mit anderen Erkrankungen und pathologischen Zust?nden assoziiert. So ist ein erh?hter oder ein ver?nderter Tau-Proteinspiegel auch bei Erkrankungen mit einem massiven akuten Neuronenzerfall, wie beispielsweise Hirninfarkten und Schlaganfall, beschrieben worden, wie auch bei chronischem Neuronenuntergang, w?hrend atropisch-degenerativer Prozesse und Creutzfeld-Jakob-Erkrankung (siehe auch Hort et al., ?Bedeutung der Gesamt-Tau und Phospho-Tau-Protein-Liquorspiegel in der Demenzdiagnostik?, Nervenarzt 2008, 79, 891?898). Daneben ist eine ganze Gruppe von neurodegenerativen Erkrankungen aufgrund des gemeinsamen Merkmals des erh?hten oder ver?nderten Tau-Proteinspiegels im Gehirn unter dem Begriff der Taupathien zusammengefasst (klassifiziert in MeSH, Version 2010, unter der Nr. DO24801). Zur Gruppe der Taupathien z?hlen insbesondere Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und progressive supranukle?re Blickparese.

Der Nachweis des Tau-Proteins erfolgt dabei bislang im Wesentlichen mittels spezifischer Antik?rper. Dabei m?ssen die ?blicherweise mit Antik?rpern assoziierten Nachteile in Kauf genommen werden. Allgemein bekannte Nachteile von Antik?rpern umfassen die M?glichkeit von Kreutzreaktivit?ten, eine kostenintensive Herstellung, hohe Variation in der Herstellung und Nachteile, die allgemein mit der Gr??e von Antik?rpern zusammenh?ngen. Es besteht somit ein Bedarf an Alternativen f?r den Nachweis von Tau-Protein.

Aufgabe der vorliegenden Erfindung ist es, Alternativen bereitzustellen, bei denen ein oder mehrere Nachteile des Standes der Technik nicht mehr auftreten oder nur noch vermindert vorhanden sind.

Die Aufgabe wird gel?st durch Bereitstellung von Aptameren, die spezifisch an humanes Tau-Protein oder ein Fragment davon binden.

Bevorzugt zeichnet sich das erfindungsgem??e Aptamer dadurch aus, dass das Aptamer mindestens eine der folgenden Nukleins?uresequenzen umfasst oder daraus besteht:

  • a) eine Sequenz mit einer der SEQ ID Nrs 2 bis 27; oder
  • b) eine Sequenz, die zu mindestens 80% identisch ist mit einer Sequenz aus a) ?ber eine Abfolge von mindestens 18 aufeinanderfolgenden Nukleotiden.

Unter dem Begriff ?Aptamer? sind im Sinne dieser Erfindung Oligonukleotide zu verstehen, die spezifisch und mit hoher Affinit?t an ein Zielmolek?l, Insbesondere humanes Tau-Protein oder ein Fragment davon, binden. Aptamere k?nnen sich unter definierten Bedingungen in eine spezifische dreidimensionale Struktur, beispielsweise so genannte Haarnadelstrukturen, falten. Vorzugsweise weist das erfindungsgem??e Aptamer wenigstens eine erste Haarnadel-Struktur umfassend einen Stamm und eine Schleife auf. Unter dem Begriff ?Haarnadelstruktur? oder ?Hairpin? ist im Sinne der vorliegenden Erfindung eine spezielle Form der Sekund?rstruktur bei Nukleins?uresequenzen, insbesondere Aptameren, zu verstehen, die sich aus zwei zueinander komplement?ren Sequenz-Abschnitten im so genannten Stamm (stem) und einem weiteren Sequenzabschnitt in der so genannten Schleife (loop) zusammensetzen, zu verstehen. Hierbei k?nnen im Stamm eine oder mehrere Basen einzelstr?ngige Bereiche so genannte Ausbuchtungen (Bulge) ausbilden.

Das erfindungsgem??e Aptamer enth?lt oder besteht aus einer Sequenz von Nukleins?urebausteinen, den Nukleotiden. Bevorzugt werden im erfindungsgem??en Aptamer unmodifizierte und/oder modifizierte D- und/oder L-Nukleotide verwendet. ?C? steht vorliegend entsprechend dem ?blichen, hier verwendeten Ein-Buchstaben-Code der Basen f?r Cytosin, entsprechend stehen ?A? f?r Adenin, ?G? f?r Guanin und ?T? f?r Thymin, ?U? f?r Uracil. Wenn im Folgenden nicht anders angegeben, umfasst der Begriff ?Nukleotid? die Begriffe ?Ribonukleotid? und ?Desoxyribonukleotid?. Entsprechend umfasst der Begriff ?2'-Fluoro-, 2'-Methoxy- und/oder 2'-Amino-modifiziertes Nukleotid? 2'-Fluoro-, 2'-Methoxy- und/oder 2'-Amino-modifizierte Ribonukleotide und Desoxyribonukleotide.

Das erfindungsgem??e Aptamer weist bevorzugt eine Anzahl an Nukleotiden im Bereich von ? 18 Nukleotide bis ? 160 Nukleotide, vorzugsweise im Bereich von ? 40 Nukleotide bis ? 120 Nukleotide, auf. Besonders bevorzugt weist das erfindungsgem??e Aptamer eine Anzahl an Nukleotiden im Bereich von ? 44 Nukleotide bis ? 120 Nukleotide, vorzugsweise im Bereich von ? 50 Nukleotide bis ? 88 Nukleotide bevorzugt im Bereich von ? 60 bis ? 80 Nukleotide auf.

Erfindungsgem?sse Aptamere k?nnen eine DNA- oder eine RNA-Sequenz aufweisen. Es versteht sich, dass f?r den Fall, dass erfindungsgem?sse Aptamere eine RNA-Sequenz aufweisen, in den angegebenen Sequenzmotiven und Sequenzen Thymidin durch Uridin ersetzt ist. Die erfindungsgem?ss geeigneten RNA-Sequenzen entsprechen den erfindungsgem?ssen DNA Sequenzen, wobei T durch U ersetzt ist.

Vorzugsweise weisen die erfindungsgem??en Aptamere eine DNA-Sequenz auf oder bestehen daraus. Aptamere auf DNA-Basis besitzen in vorteilhafter Weise eine erh?hte Stabilit?t.

Weiterhin geeignet sind Aptamere, die eine Sequenz umfassend 2'-modifizierte Nukleotide, beispielsweise 2'-Fluoro-, 2'-Methoxy- und/oder 2'-Amino-modifizierte Nukleotide, aufweisen. Auch geeignet sind Aptamere, die 2'-modifizierte Ribonukleotide, beispielsweise 2'-Fluoro-, 2'-Methoxy- und/oder 2'-Amino-modifizierte Ribonukleotide, aufweisen. Weiterhin k?nnen Aptamere Desoxyribonukleotide und 2'-modifizierte Ribonukleotide, beispielsweise 2'-Fluor-, 2'-Methoxy- und/oder 2'-Amino-modifizierte Ribonukleotide aufweisen.

Das erfindungsgem??e Aptamer kann Modifikationen aufweisen. Unter Modifikationen k?nnen z. B. die Alkylierung, insbesondere Methylierung, Arylierung oder Acetylierung von zumindest einem Nukleotid, den Einbau von Enantiomeren und/oder die Fusion von Aptameren mit einem oder mehreren Nukleotiden oder einer Nukleins?uresequenz umfassen. Solche Modifikationen k?nnen beispielsweise 5'-PEG- und/oder 3'-CAP-Modifikationen umfassen. Alternativ oder zus?tzlich kann das erfindungsgem??e Aptamer modifizierte Nukleotide aufweisen, vorzugsweise ausgew?hlt aus der Gruppe umfassend Locked-Nukleins?uren, 2'-Fluoro-, 2'-Methoxy- und/oder 2'-Amino-modifizierte Nukleotide.

Locked-Nukleins?uren (LNA, Locked Nucleic Acid) entsprechen einem konformationsfixierten Analogon von RNA. Die Oligonukleotide der Locked-Nukleins?uren enthalten ein oder mehrere bizyklische Ribonukleoside, bei denen die 2'OH-Gruppe mit dem C4-Kohlenstoffatom ?ber eine Methylengruppe verbunden ist. Vorteilhafter Weise zeigen Locked-Nukleins?uren im Vergleich zu nicht modifizierter RNA eine h?here Stabilit?t gegen?ber Nukleasen sowie bessere Hybridisierungseigenschaften, wodurch eine Verbesserung der Affinit?t und/oder Spezifit?t der Bindung des Aptamers erzielt werden kann.

Eine weitere bevorzugte chemische Modifikation ist das 5'- oder 3'-Capping der Aptamersequenz. Die Modifikation des 3'-Endes oder 5'-Endes kann das Aptamer in vorteilhafter Weise vor einem schnellen Abbau durch Nukleasen, insbesondere in einem Organismus oder einer biologischen Probe sch?tzen. Beispielsweise bietet die Einf?hrung. eines 3'-3'-dT-Cap am 3'-Ende eines Aptameres Schutz gegen?ber Exonukleasen.

In anderen Ausf?hrungsformen kann insbesondere das 5'-Ende des Aptamers pegyliert sein. Eine 5'-PEG-Modifikationen kann beispielsweise wenigstens eine Polyethylenglykol-Einheit umfassen, bevorzugt im Bereich von 1 bis 900 Polyethylenglykol-Einheiten, vorzugsweise im Bereich von 1 bis 450 Polyethylenglykol-Einheiten. Bevorzugt verwendbar sind lineare Polyethylenglykol(PEG)-Einheiten HO-(CH2CH2O)n-H, wobei n eine ganze Zahl im Bereich von 1 bis 900, bevorzugt im Bereich von 1 bis 450 ist.

In einer anderen Ausf?hrungsform der vorliegenden Erfindung k?nnen die erfindungsgem?ssen Aptamere als Phosphorothioat-DNA oder peptide nucleic acid (PNA) vorliegen. Durch diese Modifikationen k?nnen die Aptamere gegen Nukleins?ure-spaltende Enzyme stabilisiert werden. Die Stabilisierung ber?hrt die Affinit?t der modifizierten DNA-Aptamere im Wesentlichen nicht, kann jedoch die Zersetzung der Aptamere in einem Organismus oder einer biologischen Probe durch abbauende Enzyme wie Nukleasen oder DNasen verz?gern, vermindern oder sogar verhindern.

Der Vorteil einer chemischen Modifikation, einer ?nderung des Phosphorzuckerr?ckgrates oder einer Verwendung von enzymatisch nicht erkennbaren ver?nderten Nukleotidbausteinen ist, dass die verwendeten Nukleins?uren gegen einen enzymatischen Abbau, insbesondere in einem Organismus oder einer biologischen Probe, stabilisiert sind oder erw?nschte pharmakologische Eigenschaften aufweisen. Bevorzugt ber?hrt die Modifikation die Affinit?t der erfindungsgem??en Aptamere nicht.

Die erfindungsgem??en Aptamere k?nnen auch an ein Tr?germolek?l oder ein Reportermolek?l konjugiert vorliegen. Unter Tr?germolek?len k?nnen beispielsweise solche Molek?le verstanden werden, die an ein erfindungsgem??es Aptamer konjugiert werden, um die Halbwertszeit des erfindungsgem??en Aptamers in humanem Blut zu erh?hen, z. B. durch Erh?hung der Stabilit?t und/oder durch Verringerung der Ausscheidungsrate. Beispielhaft sei PEG als geeignetes Tr?germolek?l genannt. Unter Reportermolek?len werden Molek?le verstanden, die im Wesentlichen der Detektion der daran konjugierten erfindungsgem??en Aptamere dienen. Beispiele f?r geeignete Reportermolek?le sind GFP oder Reste mit radioaktiven Verbindungen, insbesondere mit PET-f?higen Radionukliden, wie beispielsweise 18F, 11C, 13N, 15O, 82Rb oder 68Ga. Weitere Beispiele f?r geeignete Tr?ger- und/oder Reportermolek?le sind Biotin, Amino-Gruppen, Phosphat-Gruppen, Cholesterol, Farbstoffe wie beispielsweise Fluoreszenzfarbstoffe sowie elektrochemisch aktive Reportermolek?le. Dar?berhinaus k?nnen die Aptamere mit zus?tzlichen DNA-Sequenzen modifiziert werden, die als Spacermolek?le dienen oder zur Konstruktion spezieller Messassays, welche eine Hybridisierungs-/Dehybridisierungsreaktion einschlie?en, verwendet werden k?nnen.

Bevorzugt weist das erfindungsgem??e Aptamer mindestens eine der folgenden Nukleins?uresequenzen auf oder besteht daraus:

  • a) eine Sequenz mit einer der SEQ ID Nrs 2 bis 27; oder
  • b) eine Sequenz, die zu mindestens 80%, bevorzugt mindestens 90%, mindestens 95%, mindestens 99% identisch ist mit einer Sequenz aus a) ?ber eine Abfolge von mindestens 18 aufeinanderfolgenden Nukleotiden, bevorzugt ?ber die gesamte L?nge der Sequenz aus a).

In einer bevorzugten Ausf?hrungsform umfasst oder besteht das erfindungsgem??e Aptamer aus:

  • a) eine Sequenz mit einer der SEQ ID Nrs 2 bis 14, besonders bevorzugt SEQ ID Nrs 2, 10, 11, 12, 14; oder
  • b) eine Sequenz, die zu mindestens 80%, bevorzugt mindestens 90%, mindestens 95%, mindestens 99% identisch ist mit einer Sequenz aus a) ?ber eine Abfolge von mindestens 18 aufeinanderfolgenden Nukleotiden, bevorzugt ?ber die gesamte L?nge der Sequenz aus a).

In einer anderen bevorzugten Ausf?hrungsform umfasst oder besteht das erfindungsgem??e Aptamer aus:

  • a) eine Sequenz mit einer der SEQ ID Nrs 15 bis 27, besonders bevorzugt mit einer der SEQ ID Nrs 15, 23, 24, 25, 27; oder
  • b) eine Sequenz, die zu mindestens 80%, bevorzugt mindestens 90%, besonders bevorzugt mindestens 95%, ganz besonders bevorzugt mindestens 99%, identisch ist mit einer Sequenz aus a) ?ber eine Abfolge von mindestens 18 aufeinanderfolgenden Nukleotiden, bevorzugt ?ber die gesamte L?nge der Sequenz aus a).

Die Sequenzen mit der SEQ ID Nrs 2 bis 14 umfassen die spezifischen Sequenzen der internen Regionen der selektierten Aptamere. Die Sequenzen mit den SEQ ID Nrs 15 bis 27 umfassen die vollst?ndigen Sequenzen der selektierten Aptamere, bestehend aus den internen Regionen (SEQ ID Nrs 2 bis 14) und den konstanten Bereichen, welche die internen Regionen am 5'-Ende bzw. am 3'-Ende flankieren. Diese konstanten Sequenzen stellen ebenso wie die internen Regionen strukturbildende Komponenten der Aptamere dar und dienten zus?tzlich als Primerbindungsorte f?r die Amplifikation der Aptamere im SELEX-Prozess. Sie sind daher ein wesentlicher Teil aller hier aufgef?hrten Aptamere.

Unter einer Sequenz, die zu mindestens 80% identisch ist mit einer Sequenz mit der SEQ ID Nr. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26 und/oder 27, wird jede Sequenz verstanden, die eine zusammenh?ngende Nukleotidkette aufweist, die mit einer Sequenz mit der SEQ ID Nr. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26 und/oder 27 ?ber eine Abfolge von 18 aufeinanderfolgenden Nukleotiden insoweit ?bereinstimmt, dass sich eine Sequenzidentit?t von mindestens 80% ergibt. Die Sequenzidentit?t kann beispielsweise mittels des blastn-Algorithmus bestimmt werden (zug?nglich ?ber http://blast.ncbi.nlm.nih.gov/Blast.cgi). Bevorzugt weist die Sequenz nach b) eine Sequenzidentit?t auf von mindestens 90%, besonders bevorzugt mindestens 95%, ganz besonders bevorzugt mindestens 99%, mit einer Sequenz mit der SEQ ID Nr. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26 und/oder 27. Die Sequenzidentit?t liegt bevorzugt ?ber eine Abfolge von 18 aufeinanderfolgenden Nukleotiden vor, besonders bevorzugt liegt die Sequenzidentit?t ?ber die gesamte L?nge einer Sequenz mit der SEQ ID Nr. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26 und/oder 27 vor.

Verfahren f?r die Selektion sowie f?r die Herstellung von Aptameren sind dem Fachmann bekannt. F?r die Suche nach Aptameren, die spezifisch f?r humanes Tau-Protein oder ein Fragment davon sind, kann beispielsweise das SELEX-Verfahren (Systematic Evolution of Ligands by EXponential enrichment) angewendet werden. Hierbei wird ein Pool verschiedener Oligonukleotide mit dem definierten Zielmolek?l kontaktiert, bindende Oligonukleotide werden selektiert und amplifiziert und in aufeinanderfolgenden Runden schrittweise im Pool angereichert. Hierzu wird im Einzelnen auf die folgenden Literaturstellen verwiesen: Tuerk & Gold, Science 249 (1990) 505?510, sowie Ellington & Szostak, Nature 346 (1990) 818?822. Die so erhaltenen Oligonukleotide bzw. Aptamere eignen sich beispielsweise zur Detektion von humanem Tau-Protein oder von Fragmenten davon in einem Bindungsassay oder sie k?nnen in der Diagnose, Prophylaxe und/oder Therapie von Erkrankungen eingesetzt werden.

Das erfindungsgem??e Aptamer bindet spezifisch an humanes Tau-Protein oder ein Fragment davon. Das Tau-Protein bindet an Mikrotubulinstrukturen, ist an der Regulation des Zytoskeletts beteiligt und wird durch das MAPT-Gen kodiert. Im menschlichen Zentralnervensystem kommen insgesamt 9 Isoformen des humanen Tau-Proteins vor:
Isoform PNS-tau: Diese Isoform umfasst die kanonische Sequenz, die sich aus dem MAPT-Gen ergibt. Diese Sequenz, mit Aminos?uren 2 bis 758, wird f?r die Zwecke der vorliegenden Erfindung bevorzugt unter dem Begriff ?humanes Tau-Protein? verstanden.
Isoform Fetal-tau: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminos?uren an den Positionen folgenderma?en ver?ndert sind (die Positionen sind jeweils auf die Volll?ngensequenz des humanen Tau-Proteins mit 758 Aminos?uren bezogen): 45?73, 74?102, 125?375, 395?460 und 592?622 fehlen.
Isoform Tau-A: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminos?uren an den Positionen folgenderma?en ver?ndert sind (die Positionen sind jeweils auf die Volll?ngensequenz des humanen Tau-Proteins mit 758 Aminos?uren bezogen): 1?44: MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLK ? MLRALQQRKR; 45?73, 74?102, 103?104, 125?375, 395?460 und 592?622 fehlen.
Isoform Tau-B: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminos?uren an den Positionen folgenderma?en ver?ndert sind (die Positionen sind jeweils auf die Volll?ngensequenz des humanen Tau-Proteins mit 758 Aminos?uren bezogen): 74?102, 125?375, 395?460 und 592?622 fehlen.
Isoform Tau-C: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminos?uren an den Positionen folgenderma?en ver?ndert sind (die Positionen sind jeweils auf die Volll?ngensequenz des humanen Tau-Proteins mit 758 Aminos?uren bezogen): 125?375, 395?460 und 592?622 fehlen.
Isoform Tau-D: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminos?uren an den Positionen folgenderma?en ver?ndert sind (die Positionen sind jeweils auf die Volll?ngensequenz des humanen Tau-Proteins mit 758 Aminos?uren bezogen): 45?73, 74?102, 125?375 und 395?460 fehlen.
Isoform Tau-E: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminos?uren an den Positionen folgenderma?en ver?ndert sind (die Positionen sind jeweils auf die Volll?ngensequenz des humanen Tau-Proteins mit 758 Aminos?uren bezogen): 74?102, 125?375 und 395?460 fehlen.
Isoform Tau-F: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminos?uren an den Positionen folgenderma?en ver?ndert sind (die Positionen sind jeweils auf die Volll?ngensequenz des humanen Tau-Proteins mit 758 Aminos?uren bezogen): 125?375 und 395?460 fehlen.
Isoform Tau-G: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminos?uren an den Positionen folgenderma?en ver?ndert sind (die Positionen sind jeweils auf die Volll?ngensequenz des humanen Tau-Proteins mit 758 Aminos?uren bezogen): 502-502: S ? SATKQVQRRPPPAGPRSER

Das erfindungsgem??e Aptamer kann bevorzugt an solche Isoformen des humanen Tau-Proteins binden, die im menschlichen Gehirn vorkommen, dies sind insbesondere Fetal-Tau, Tau-B, Tau-C, Tau-D, Tau-E und Tau-F.

Das erfindungsgem??e Aptamer bindet besonders bevorzugt spezifisch an ein Peptid des humanen Tau-Proteins mit der SEQ ID Nr. 1, welches die Aminos?uren 226 bis 240 umfasst oder daraus besteht, wobei die Positionen jeweils auf die Aminos?uresequenz der Isoform Tau-441 (= Tau-F, l?ngste der 6 Tau-Isoformen, die im menschlichen Gehirn vorkommen) bezogen sind, oder an ein Fragment davon.

Unter einem Fragment des humanen Tau-Proteins wird jede Aminos?uresequenz verstanden, die mindestens 6, bevorzugt mindestens 10, Aminos?uren umfasst und identisch ist mit einer Sequenz aus einer der 9 Isoformen, bevozugt identisch mit einer Sequenz aus der Volll?ngensequenz des humanen Tau-Proteins mit 758 Aminos?uren, besonders bevorzugt identisch ist mit einer Sequenz aus der SEQ ID Nr. 1.

Die Bindungsf?higkeit der selektierten Aptamere wird durch die Affinit?t (Sensitivit?t) der Bindung (ausgedr?ckt durch die Dissoziationskonstante KD) beschrieben. In einer bevorzugten Ausf?hrungsform der Erfindung weisen die erfindungsgem??en Aptamere an humanem Tau-Protein, bevorzugt an dem Peptid mit der SEQ ID Nr. 1 oder einem Fragment davon, eine KD von nicht mehr als 500 nM auf, vorzugsweise nicht mehr als 100 nM, besonders bevorzugt von 0.001 bis 500 nM, ganz besonders bevorzugt von 0.01 bis 100 nM.

Die Erfindung betrifft auch eine pharmazeutische Zusammensetzung, die mindestens eines der erfindungsgem??en Aptamere umfasst, vorzugsweise zusammen mit mindestens einem pharmazeutisch akzeptablen, annehmbaren oder vertr?glichen Hilfsstoff und/oder Tr?ger. Eine pharmazeutische Zusammensetzung im Sinne der Erfindung ist jedes Mittel, welches in der Diagnose und/oder Therapie von Patienten eingesetzt werden kann, die zumindest zeitweise eine Erkrankung, eine pathogene Modifikation des Gesamtzustandes bzw. des Zustandes einzelner Teile des Patientenorganismus zeigen.

Die pharmazeutische Zusammensetzung kann das Aptamer als ein akzeptables Salz umfassen. Hierbei kann es sich beispielsweise um Salze anorganischer S?uren, wie z. B. der Phosphors?ure, oder um Salze organischer S?uren handeln. Die jeweilige Dosis bzw. der Dosisbereich f?r die Gabe der erfindungsgem??en pharmazeutischen Zusammensetzung ist gro? genug, um den gew?nschten diagnostischen oder therapeutischen Effekt der Bindung an humanes Tau-Protein oder ein Fragment davon zu erreichen. Im Allgemeinen wird die Dosis mit dem Alter, der Konstitution und dem Geschlecht des Patienten variieren sowie die Schwere der Erkrankung ber?cksichtigen. Es versteht sich, dass die spezifische Dosis, H?ufigkeit und Dauer der Verabreichung dar?ber hinaus von einer Vielzahl an Faktoren abh?ngen, wie z. B. der Bindungsf?higkeit der Aptamere, Ern?hrungsgewohnheiten des zu behandelnden Individuums, Art der Verabreichung, Ausscheidungsrate und Kombination mit anderen Medikamenten. Die individuelle Dosis kann sowohl in Bezug auf die prim?re Erkrankung als auch in Bezug auf das Eintreten eventueller Komplikationen eingestellt werden. Die exakte Dosis ist durch einen Fachmann mit bekannten Mitteln und Methoden feststellbar.

In einer Ausf?hrungsform der Erfindung werden die Aptamere in einer Dosis von 0.01 mg bis 1 g pro Kilogramm K?rpergewicht und pro Tag verabreicht. Vorzugsweise werden jedoch Dosen von 20 bis 60 mg pro Kilogramm K?rpergewicht und pro Tag verabreicht.

Zur Unterst?tzung der medizinischen Wirkung kann die pharmazeutische Zusammensetzung in einer bevorzugten Ausf?hrungsform der Erfindung auch weitere Wirkstoffe umfassen, wie z. B. eines oder mehrere verschiedene Aptamere und/oder Antik?rper.

Erfindungsgem?? ist das Aptamer und/oder die pharmazeutische Zusammensetzung zur diagnostischen oder therapeutischen Behandlung von Erkrankungen geeignet, die mit einer Ver?nderung im Tau-Proteinspiegel, bevorzugt in humanem Tau-Proteinspiegel, einhergeht. Erkrankungen im Sinne der vorliegenden Erfindung, die mit einem ver?nderten Tau-Proteinspiegel einhergehen, umfassen Erkrankungen mit einem massiven akuten Neuronenzerfall, wie beispielsweise Hirninfarkte und/oder Schlaganfall, Erkrankungen mit chronischem Neuronenuntergang, Erkrankungen mit atropisch-degenerativen Prozessen und Taupathien. Bevorzugte Erkrankungen, die mit einer Ver?nderung im Tau-Proteinspiegel einhergehen sind Hirninfarkt, Schlaganfall, Creutzfeld-Jakob-Erkrankung, Taupathien, Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und/oder progressive supranukle?re Blickparese.

Die pharmazeutische Zusammensetzung der vorliegenden Erfindung kann oral, transmucosal, rektal, pulmonal, enteral und/oder parenteral angewendet werden. Bevorzugt ist eine direkte Injektion in den K?rper. Die gew?hlte Art der Verabreichung richtet sich nach der Indikation, der zu verabreichenden Dosis, Individuums-spezifischen Parametern etc. Insbesondere erm?glichen die verschiedenen Arten der Verabreichung eine ortspezifische Therapie, die Nebenwirkungen minimiert und die Wirkstoffdosis verringert. Bevorzugte Injektionen sind die intradermale, subkutane, intramuskul?re oder intraven?se Injektion. Die Applikation kann z. B. mit Hilfe sogenannter Impfpistolen, die die erfindungsgem??en Aptamere mittels Goldkugeln in die Haut einbringen, oder mittels Spritzen, die die erfindungsgem??en Aptamere unter die Haut oder in den Muskel einbringen, geschehen. Es ist auch m?glich, das Aptamer als Aerosol bereitzustellen, welches von dem Organismus, bevorzugt einem humanen Patienten, inhaliert wird.

Um die protektive oder therapeutische Wirkung der erfindungsgem??en Aptamere zu erh?hen, k?nnen den daraus hergestellten pharmazeutischen Zusammensetzungen pharmazeutisch vertr?gliche Hilfsstoffe, wie z. B. Adjuvantien, zugesetzt werden. im Sinne der Erfindung ist jede Substanz, die mit den erfindungsgem??en Aptameren eine Wirkung erm?glicht, verst?rkt oder modifiziert, ein Adjuvants. Bekannte Adjuvantien sind beispielsweise Aluminiumverbindungen, wie z. B. Aluminiumhydroxid oder Aluminiumphosphat, Saponine, wie z. B. QS 21, Muramyldipeptid oder Muramyltripeptid, Proteine, wie z. B. Gammainterferon oder TNF, MF 59, Phosphatdibylcholin, Squalen oder Polyole. Des Weiteren kann DNA, die eine immunstimulatorische Eigenschaft hat, oder die ein Protein mit Adjuvants-Effekt kodiert, wie z. B. ein Cytokin, parallel oder in einem Konstrukt appliziert werden.

Das pharmazeutische Mittel kann als Tablette, Kapsel, Pulver, L?sung, Dispersion oder Suspension vorliegen. Die Darreichungsformen des pharmazeutischen Mittels werden mit den ?blichen festen oder fl?ssigen Tr?gerstoffen und/oder Verd?nnungsmitteln und den ?blicherweise eingesetzten Hilfsstoffen entsprechend der gew?nschten Applikationsart in einer geeigneten Dosierung und in an sich bekannter Weise hergestellt.

Ein weiterer Gegenstand der Erfindung betrifft die Verwendung der erfindungsgem??en Aptamere zur Diagnose oder Therapie von Erkrankungen, die mit einer Ver?nderung in humanem Tau-Proteinspiegel einhergehen, insbesondere von Hirninfarkt, Schlaganfall, Creutzfeld-Jakob-Erkrankung, Taupathien, Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und/oder progressive supranukle?re Blickparese.

Noch ein weiterer Gegenstand der Erfindung betrifft die Verwendung dieser Aptamere zur Herstellung eines Medikaments zur Diagnose oder Therapie von Erkrankungen, die mit einer Ver?nderung im Tau-Proteinspiegel einhergehen, insbesondere von Hirninfarkt, Schlaganfall, Creutzfeld-Jakob-Erkrankung, Taupathien, Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und/oder progressive supranukle?re Blickparese.

Unter dem Begriff ?Diagnose? wird, f?r die Zwecke der vorliegenden Erfindung, jedes planm??ige Vorgehen verstanden, welches die Erhebung von Befunden, Ph?nomenen oder Symptomen und/oder deren Klassifizierung zu einer Kategorie bzw. deren Interpretation umfasst. Insbesondere erfasst der Begriff ?Diagnose? die Erhebung und/oder Zuordnung von Befunden, Ph?nomenen oder Symptomen zu einem Krankheitsbegriff oder einer spezifischen Erkrankung.

So wie hierin verwendet, bezeichnet der Begriff ?Therapie? die Umkehrung, Linderung oder Hemmung des Fortschreitens einer Erkrankung, St?rung oder eines Zustands oder eines oder mehrerer Symptome einer solchen Erkrankung, St?rung oder eines solchen Zustands, auf welche dieser Begriff zutrifft. So wie hierin verwendet, kann ?Therapie? sich auch darauf beziehen, dass die Wahrscheinlichkeit oder H?ufigkeit, mit der eine Erkrankung, St?rung oder ein Zustand bei einem S?uger im Vergleich zu einer unbehandelten Kontrollpopulation oder im Vergleich zum gleichen S?uger vor der Behandlung auftritt, verringert wird. So wie hierin verwendet, kann ?Therapie? sich beispielsweise auch auf die Pr?vention einer Erkrankung, St?rung oder eines Zustands beziehen und kann auch die Verz?gerung oder Verh?tung des Beginns einer Erkrankung, St?rung oder eines Zustands oder die Verz?gerung oder Verh?tung der mit einer Erkrankung, St?rung oder eines Zustands verbundenen Symptome umfassen. So wie hierin verwendet, kann ?Therapie? sich auch darauf beziehen, dass die Schwere einer Erkrankung, St?rung oder eines Zustands oder von Symptomen, die mit einer solchen Erkrankung, St?rung oder eines solchen Zustands verbunden sind, verringert wird, ehe der S?uger von der Erkrankung, St?rung oder dem Zustand befallen wird. Eine solche Pr?vention oder Verringerung der Schwere einer Erkrankung, St?rung oder eines Zustands vor dem Befallensein betrifft die Verabreichung der Zusammensetzung der vorliegenden Erfindung ? wie hierin beschrieben ? an ein Individuum, das zum Zeitpunkt der Verabreichung nicht von der Erkrankung, St?rung oder dem Zustand befallen ist. So wie hierin verwendet, kann ?Therapie? sich auch darauf beziehen, dass das Wiederauftreten einer Erkrankung, St?rung oder eines Zustands oder eines oder mehrerer mit einer solchen Erkrankung, St?rung oder einem solchen Zustands verbundenen Symptome verhindert wird. So wie hierin verwendet, bezieht sich der Begriff ?therapeutisch? auf den Akt des Behandelns im Sinne der obigen Definition von ?Therapie?.

Die vorliegende Erfindung bezieht sich auch auf ein Verfahren zur Diagnose oder Therapie von Erkrankungen, die mit einer Ver?nderung im Tau-Proteinspiegel einhergehen, insbesondere von Hirninfarkt, Schlaganfall, Creutzfeld-Jakob-Erkrankung, Taupathien, Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und/oder progressive supranukle?re Blickparese, wobei einem Patienten, der einer solchen Diagnose oder Therapie bedarf, eine wirksame Dosis des erfindungsgem??en Aptamers oder der erfindungsgem??en pharmazeutischen Zusammensetzung verabreicht wird.

Gem?? vorliegender Erfindung wird das erfindungsgem??e Aptamer bzw. die erfindungsgem??e pharmazeutische Zusammensetzung vorzugsweise in einer wirksamen Dosis verabreicht. Eine ?wirksame Dosis? ist die Dosis, die bei Verabreichung an einen Patienten eine messbare therapeutische Wirkung im Hinblick auf die fragliche Krankheit bewirkt.

Die Erfindung bezieht sich ferner auf ein Verfahren zur Aufreinigung von humanem Tau-Protein oder Fragmenten davon, dadurch gekennzeichnet, dass eine Probe, die humanes Tau-Protein oder ein Fragment davon enth?lt, mit mindestens einem erfindungsgem??en Aptamer kontaktiert wird, und der Komplex aus Aptamer und humanem Tau-Protein oder einem Fragment davon von der restlichen Probe abgetrennt wird. Ggf kann in einem weiteren, optionalen Schritt der Komplex in das humane Tau-Protein oder das gebundene Fragment davon und das erfindungsgem??e Aptamer gespalten werden, so dass Aptamer und humanes Tau-Protein (bzw. das Fragment davon) voneinander separiert werden k?nnen.

Eine Probe im Sinne der Erfindung ist ein bereitgestelltes oder durch Probenentnahme erhaltenes biologisches oder chemisches Material oder ein Teil bzw. eine kleine Menge eines solchen Materials, von dem angenommen wird, dass es humanes Tau-Protein oder ein Fragment davon umfasst, oder dessen Beschaffenheit chemisch, biologisch, klinisch oder ?hnlich gepr?ft werden soll auf das Vorhandensein von humanem Tau-Protein oder einem Fragment davon. Eine Probe k?nnen insbesondere alle biologischen Materialien sein, die von Individuen isoliert worden sind, beispielsweise biologische Gewebe und Fl?ssigkeiten, zu denen u. a. Blut, Haut, Plasma, Serum, Lymphe, Urin, Gehirnfl?ssigkeit, CSF, Tr?nen, Abstriche, Gewebeproben, Organe und Tumore z?hlen. Vorliegend sind in Proben auch Bestandteile von Zellkulturen eingeschlossen. Die Probenentnahme erfolgt beispielsweise derart, dass die entnommene Teilmenge einem repr?sentativen Durchschnitt der gesamten Menge entspricht. Die durch Untersuchung der Probe ermittelten Merkmale dienen der Beurteilung der durch die Probe erfassten Menge, die wiederum R?ckschl?sse auf die Gesamtmenge, beispielsweise das Blut bzw. die Lymphe in einem Organismus, zul?sst. F?r die Untersuchung k?nnen die Proben vorbehandelt, wie z. B. durch Mischen, Zugabe von Enzymen oder Markern, oder aufgereinigt werden.

Die Probe wird mit mindestens einem der erfindungsgem??en Aptamere kontaktiert. Unter einer Kontaktierung im Sinne der Erfindung kann beispielsweise eine Inkubation der Probe und der darin enthaltenen Verbindungen mit einem erfindungsgem??en Aptamer verstanden werden. Dabei ist es m?glich die Zug?nglichkeit von Verbindungen in der Probe z. B. durch chemische L?sungen und/oder physikalische Methoden, wie z. B. Erhitzen, zu verbessern.

Nach einer Inkubationszeit werden die spezifischen Produkte, d. h. die Komplexe aus Aptamer und humanem Tau-Protein oder einem Fragment davon, von der restlichen Probenl?sung abgetrennt. Geeignete Methoden sind dem Fachmann bekannt, wie z. B. Dialyse, Ultrafiltration, Gelfiltration, F?llung, Chromatographie, magnetische Trennung oder einfach Waschschritte. Der Komplex kann dabei immobilisiert vorliegen.

Durch Ver?nderungen der f?r die Aptamerbindung erforderlichen definierten Bedingungen kann in einem weiteren, optionalen Schritt der Komplex getrennt werden. Hierzu k?nnen physiko-chemische Einwirkungen, wie z. B. eine Variation von Salzkonzentration oder pH oder eine hitzebedingte Denaturierung, angewendet werden. Abschlie?end ist eine weitere Reinigung der Verbindung m?glich, wobei das Aptamer zuvor abgebaut werden kann, z. B. durch saure (thermische) Hydrolyse oder DNasen. Sofern das Aptamer immobilisiert ist, kann die aufgereinigte Verbindung eluiert werden, wie z. B. von einer S?ule, die anschlie?end regeneriert und wiederverwendet wird.

Erfindungsgem?? k?nnen die Aptamere auch an einer festen Phase immobilisiert vorliegen, vorzugsweise ?ber ein Spacer-Molek?l, das beispielsweise eine Linker-Nukleins?ure umfassen kann. Geeignete Methoden der Immobilisierung sind dem Fachmann bekannt, die sowohl mit einer kovalenten Kopplung als auch einer nicht-kovalenten Kopplung mittels geeigneter Affinit?tspaare, wie z. B. Biotin/Streptavidin, einhergehen k?nnen. Die feste Phase k?nnen beispielsweise Platten, Streifen, Membranen, Filme, Gele oder Perlen sein. Geeignete Tr?germaterialien sind anorganische und organische Polymere. Hierzu z?hlen Kunststoffe, vorzugsweise auf Basis von Polystyrol. Des weiteren sind Biopolymere, vorzugsweise Cellulose, Dextran, Agar, Agarose und Sephadex, die funktionalisiert sein k?nnen, insbesondere als Nitrocellulose oder Cyanbromid-Sephadex, Polymere im erfindungsgem??en Verfahren. Aptamere k?nnen an Magnetic Beads gebunden werden, die z. B. Carboxy-terminierte, Amino-terminierte, Tosyl-aktivierte oder Epoxy-aktivierte Seitenketten tragen. Des Weiteren ist eine Kopplung von Magnetic Beads an die Desoxyribose der Aptamere m?glich. Die Beispiele f?r Polymere sind nicht limitierend und andere Molek?le denkbar. Bevorzugte Kombinationen von geometrischer Form und Material sind Gele aus Biopolymeren, insbesondere Agarose, und Gelmatrices aus Dextran und Sephadex, die ? beispielsweise in S?ulen verpackt ? Hohlr?ume definierter Porengr??e ausbilden.

Die Erfindung betrifft auch ein Verfahren zum Nachweis von humanem Tau-Protein oder Fragmenten davon, dadurch gekennzeichnet, dass die zu untersuchende Probe mit mindestens einem erfindungsgem??en Aptamer inkubiert und ein Bindungsereignis zwischen dem Aptamer und humanem Tau-Protein oder einem Fragment davon nachgewiesen wird.

Die Probe und das Aptamer werden gem?? der vorherigen Lehre dieser Erfindung gewonnen, vorbereitet, wie z. B. immobilisiert, und inkubiert, im Ergebnis dessen das Aptamer und ein in der Probe vorhandenes Tau-Protein oder ein Fragment davon einen Komplex bilden. Das Bindungsereignis kann beispielsweise elektrochemisch, optisch, mikrogravimetrisch, kalorimetrisch oder piezoelektrisch nachgewiesen werden. Bei einem markierungsfreien Nachweis kann das Aptamer beispielsweise auf einer Oberfl?che fixiert werden und die ?nderung der Schichtdicke nach Anlagerung der Tau-Proteine oder der Fragmente davon mit einer der genannten Methoden bestimmt werden, wie z. B. optisch ?ber eine ?nderung des Evaneszenz-Feldes. Meist ist die Komplexierung nicht direkt detektierbar und wird vorzugsweise in einer Indikatorreaktion nach einer direkten oder indirekten Kopplung eines Komplexpartners mit einer gut nachweisbaren Markierungssubstanz sichtbar gemacht. Das bedeutet, entweder ist das verwendete Aptamer oder das Tau-Protein bzw. das Fragment davon mit einer Markierung versehen. Bevorzugt ist das Aptamer markiert.

In einer Ausgestaltung des Verfahrens der Erfindung kann die Markierung durch Lumineszenz, UV/VIS-Farbgebung, enzymatisch, elektrochemisch oder radioaktiv erfolgen. Lumineszenz betrifft die Emission von Licht. Im erfindungsgem??en Verfahren finden vorzugsweise die Photolumineszenz, die Chemilumineszenz und die Biolumineszenz zum Nachweis der Markierung Anwendung. Bei der Photolumineszenz oder Fluoreszenz erfolgt die Anregung durch Absorption von Photonen. Bevorzugte Fluorophore sind Bisbenzimidazole, die kovalent an Aptamere oder Nachweisreagenzien auf DNA-Basis gekoppelt werden, Fluorescein, Acridinorange, Cy5, Cy3 oder Propidiumiodid. Die Auswertung geschieht visuell oder mit entsprechenden Messger?ten, z. B. im Fluoreszenzmikroskop oder Fluorimeter, oder durch Durchflusscytometrie, z. B. im Cytofluorimeter. Chemilumineszenz beschreibt die Emission sichtbaren Lichts als Folge einer chemischen Reaktion. Eine bevorzugte chemische Markierung zur Chemilumineszenz ist Luminol, das nach Oxidation, wie z. B. mit H2O2, eine intensive blaue Chemilumineszenz zeigt. Biolumineszenz beinhaltet die Emission sichtbaren Lichts als Folge einer durch das Enzym Luciferase katalysierten Redoxreaktion.

Dar?ber hinaus kann der Nachweis mit weiteren Enzymen als Markierungssubstanzen gef?hrt werden, die Substrate zu farbigen Produkten umsetzen, vorzugsweise Peroxidase, Chloramphenicol Acetyltransferase (CAT), GFP (sog. ?green fluorescent protein?), Glutathion-S-Transferase (GST), Luciferase, ?-Galactosidase oder Alkalische Phosphatase. Beispielsweise wird das farblose Substrat X-Gal durch die Aktivit?t der ?-Galactosidase zu einem blauen Produkt umgesetzt, dessen Farbgebung visuell erfasst werden kann. Die Alkalische Phosphatase (AP) setzt 5-Brom-4-Chlor-3-Indolylphosphat (BCIP oder X-Phosphat) und Nitroblau-Tetrazoliumsalz (NBT) farbig um. Die Farbstoffe fallen dabei in unmittelbarer N?he der AP-Molek?le aus und f?rben die Umgebung der gebundenen Verbindungen dunkelviolett an. Die Peroxidase katalysiert z. B. die Oxidation von ABTS (2,2'-Azino-bis-[3-ethylbenzthiazolin-6-sulfons?ure]) in Gegenwart von H2O2. Aufgrund der Enzymstabilit?t und einer Vielzahl an m?glichen Substraten ist die Meerrettich-Peroxidase bevorzugt.

In Enzymelektroden wirken immobilisierte Enzyme als Rezeptor und ein elektrochemisches Messsystem fungiert als Transduktor. Im Sinne der vorliegenden Erfindung k?nnen die Enzyme sowohl auf Aptameren oder Nachweisreagenzien f?r die Inkubationskomplexe, oder auf einem externen Tr?ger immobilisiert sein. Die Enzyme liefern durch Bildung oder Abbau elektrodenaktiver Substrate ein direktes chemisches Signal, das vom Transduktor in ein elektrisches Signal umgewandelt wird. Die Substrate befinden sich kontr?r zu den immobilisierten Enzymen an einem externen Tr?ger, oder sind kovalent an Aptamere der vorliegenden Erfindung oder Nachweisreagenzien der Komplexe gekoppelt. Bevorzugte Systeme basieren auf spezifischen Oxidasen, wie z. B. der Glucoseoxidase, wobei Coenzyme ?ber Redoxmediatoren die Verkn?pfung mit elektrochemischen oder optischen Sensorelementen gew?hrleisten.

Alternativ kann der Nachweis auch radioaktiv mit radioaktiven Isotopen erfolgen, vorzugsweise 3H, 14C, 32P, 33P, 35S oder 125I, besonders bevorzugt 32P, 33P oder 125I. Bei der Sintillationsz?hlung wird z. B. ein Molek?lcocktail durch radioaktive ?-Strahlung angeregt. Die beim ?bergang in den Grundzustand als Licht freigesetzte Energie wird durch einen Photoelektronenvervielfacher verst?rkt und gez?hlt.

Die Aptamere k?nnen auch mit Digoxigenin oder Biotin markiert sein, die beispielsweise durch Antik?rper oder Streptavidin gebunden werden, die wiederum eine Markierung tragen k?nnen, wie z. B. ein Enzymkonjugat. Ist das Aptamer an ein Enzym gekoppelt, spricht man vom ELONA (enzyme-linked oligonucleotide assay). Die vorherige kovalente Verkn?pfung (Konjugation) eines Aptamers mit einem Enzym kann auf verschiedene bekannte Arten erfolgen. Der Nachweis der Aptamer-Bindung kann auch radioaktiv in einem dem RIA (radioactive immunoassay) entsprechenden Assay mit radioaktiven Isotopen, vorzugsweise mit 125I, oder durch Fluoreszenz in einem dem FIA (Fluoroimmunoassay) entsprechenden Assay mit Fluorophoren, vorzugsweise mit Fluorescein oder FITC, erfolgen.

Alle genannten Methoden schlie?en intensive Waschschritte ein, um ungebundene und/oder unspezifisch gebundene Aptamere und/oder Nachweisreagenzien abzutrennen. Die Durchf?hrung s?mtlicher Nachweisverfahren ist dem Fachmann bekannt. Der direkte Nachweis der Markierung ist im vorliegenden Verfahren der Erfindung bevorzugt, insbesondere der direkte Nachweis durch Fluoreszenz.

In einer weiteren Ausgestaltung des Verfahrens wird der Nachweis in-situ durchgef?hrt. Diese Umsetzung erfordert einen geeigneten Inkubationsraum, auf dem der Nachweis einfach durchgef?hrt und sichtbar gemacht werden kann. Hierzu wird vorteilhaft ein fester Tr?ger verwendet, der es erm?glicht, Probe, Aptamere und ggf. Nachweisreagenzien der Komplexe zu fixieren. Die Aptamere k?nnen sowohl vor oder nach der Probe auf den festen Tr?ger aufgebracht werden. Methoden der Immobilisierung vorgenannter Aptamere sind dem Fachmann bekannt und werden vorzugsweise nicht in-situ, sondern w?hrend oder im Anschluss an die Produktion des festen Tr?gers durchgef?hrt. F?r den Nachweis kommen beispielsweise ein visueller Farbnachweis oder ein elektrochemischer Nachweis in Frage. Im Farbnachweis k?nnen die Aptamere markiert sein, so dass direkt im Anschluss an die Inkubation ein Ablesen und Auswerten realisiert werden kann.

Die Erfindung betrifft auch die Verwendung der erfindungsgem??en Aptamere zur Aufreinigung und/oder zum Nachweis von humanem Tau-Protein oder Fragmenten davon. Das erfindungsgem??e Aptamer ist insbesondere zur Affinit?tsreinigung und/oder Affinit?tschromatographie geeignet. Das erfindungsgem??e Aptamer kann auch als Rezeptorelement f?r Biosensoren, in der klinischen Analytik, Umweltanalytik und/oder Prozess?berwachung der pharmazeutischen und chemischen Industrie vorteilhaft eingesetzt werden.

Die Erfindung lehrt des Weiteren einen Kit, der mindestens eines der erfindungsgem??en Aptamere umfasst. Neben dem erfindungsgem??en Aptamer kann der Kit weitere aktive Stoffe und/oder Hilfsstoffe enthalten. Der Kit kann gegebenenfalls Verbrauchsmaterialien wie z. B. Beh?lter, Reaktionsgef??e und/oder K?vetten enthalten, die f?r die Lagerung und/oder die Nachweisreaktion geeignet sind.

Im Rahmen der vorliegenden Erfindung wurden also erstmalig Aptamere bereitgestellt, die an humanes Tau-Protein bzw. Fragmente davon binden. Bei den erfindungsgem??en Aptameren handelt es sich um Aptamere, deren Sequenzen bisher nicht beschrieben sind. Die Aptamere zeichnen sich durch eine hohe Affinit?t und eine ausgepr?gte Spezifit?t f?r humanes Tau-Protein aus. Diese Eigenschaften bilden die Grundlage f?r eine zuverl?ssige Erkennung, womit das Fehlen von Kreuzreaktivit?ten eingeschlossen ist, und einen reproduzierbaren Nachweis von humanem Tau-Protein oder Fragmenten davon. Die Affinit?t und Spezifit?t der erfindungsgem??en Aptamere ist damit grunds?tzlich mit denen von Antik?rpern vergleichbar oder sogar besser. Die erfindungsgem?? zur Verf?gung gestellten Aptamere k?nnen kosteng?nstig in-vitro hergestellt werden. Im Vergleich zur Antik?rpertechnologie beispielsweise werden keine Versuchstiere f?r Immunisierungszwecke ben?tigt. Die Aptamere auf DNA-Basis besitzen auch eine hohe Stabilit?t und sind nicht zuletzt aufgrund ihrer geringen Gr??e gut zu handhaben.

Die erfindungsgem??en Aptamere k?nnen einzeln oder in Mischungen enthaltend mehrere verschiedene erfindungsgem??e Aptamere verwendet werden.

Die erfindungsgem??en Aptamere k?nnen auch in Kombination mit anderen Substanzen verwendet werden, die spezifisch an Zielstrukturen binden k?nnen, wie z. B. andere Aptamere oder Antik?rper. Solche Kombinationen k?nnen in Assays zum Nachweis von Zielstrukturen zum Einsatz kommen, beispielsweise in Form von sogenannten ?sandwich?-Assays bei denen ein spezifischer Binder dazu dient die Zielstruktur zu isolieren und der zweite Binder zum Nachweis von isolierten Zielstrukturen verwendet wird. Solche Assays k?nnen beispielsweise als ELISA, ELONA, RIA oder Streifen-Assays ausgebildet sein, wobei das erfindungsgem??e Aptamer gegebenenfalls an einem festen Tr?ger immobilisiert vorliegen kann.

Die erfindungsgem??en Aptamere k?nnen insbesondere in der Differentialdiagnostik der oben genannten Erkrankungen, bevorzugt in der Differentialdiagnostik der Creutzfeldt-Jakob-Erkrankung und/oder Alzheimer eingesetzt werden. Bei der Creutzfeldt-Jakob-Erkrankung wurde beobachtet, dass im Liquor das Gesamt-Tau-Protein h?her ist als das Phospho-Tau. Bei Alzheimer wurde ein erh?hter Tau-Protein-Spiegel und erniedrigter A?42-Spiegel in CSF gefunden. Der Quotient Tau/A?42 k?ndigt schon bei asymptomatischen Probanden eine zuk?nftige Demenz-Erkrankung an.

Die erfindungsgem??en Aptamere k?nnen auch gemeinsam mit Antik?rpern eingesetzt werden. Beispielsweise zur Differentialdiagnostik, wobei f?r verschiedene Formen/Fragmente der nachzuweisenden Zielstrukturen entweder Aptamere oder Antik?rper verwendet werden. Ebenso k?nnen erfindungsgem??e Aptamere und Antik?rper in Sandwich-Assays kombiniert werden. Dann sind ein Aptamer und ein Antik?rper in der Lage, gleichzeitig an ein Zielmolek?l (Tau Protein oder Fragment) zu binden. Beispielsweise dient das (immobilisierte) Aptamer dazu, das Zielmolek?l zu binden, und der Antik?rper tr?gt eine Markierung, so dass nach seiner Bindung an das Zielmolek?l ein Signal erzeugt wird. Ebenso ist es m?glich, den Antik?rper zur Zielmolek?l-Bindung und das Aptamer f?r den Nachweis zu nutzen.

Im Folgenden wird die Erfindung anhand von Ausf?hrungsbeispielen n?her erl?utert.

Figuren:

1. zeigt schematisch den Aufbau der verwendeten synthetischen single stranded (ss) DNA-Bibliothek.

2. zeigt den SELEX-Verlauf zur Selektion von DNA-Aptameren, spezifisch f?r das Tau-Peptid Tau226-240. Darstellung der Menge an targetgebundener ssDNA, eluiert von den entsprechenden Tau-modifizierten Streptavidin-Magnetic Beads im Target-Selektionsschritt jeder SELEX-Runde. Au?erdem wurde ein Negativ-Selektionsschritt in jeder Runde durchgef?hrt und zus?tzlich ein Subtraktionsschritt in Runde 10, 11 und 12.

3. zeigt vergleichende Bindungsversuche mit ausgew?hlten Aptamer-Klonen.

4. zeigt die S?ttigungskurve von Aptamer-Klon #5/60.

Ausf?hrungsbeispiele:

Die Tau-spezifischen Aptamere wurden unter Anwendung des FluMag-SELEX-Prozesses, einer in vitro Selektions- und Amplifikationsmethode, selektiert. Der FluMag-SELEX-Prozess ist ein fluoreszenzkontrollierter Selektionsprozess zur Gewinnung von ssDNA Aptameren f?r ein spezifisches Target. Die Targetmolek?le werden dabei auf Magnetic Beads, verf?gbar mit verschieden funktionalisierten Oberfl?chen, immobilisiert. Der FluMag-SELEX-Prozesses ist beschrieben in Stoltenburg et al., ?FluMag-SELEX as an advantageous method for DNA aptamer selection?, Anal Bioanal Chem. 2005; 383(1): 83?91.

Ausgangspunkt des FluMag-SELEX-Prozesses ist im vorliegenden Fall eine synthetische ssDNA-Bibliothek, deren Aufbau in 1 dargestellt ist und deren Oligonukleotide jeweils eine L?nge von 76 nt besitzen. Diese sind au?erdem durch eine innere Region von 40 nt mit variabler Nukleotidabfolge charakterisiert, welche von zwei unterschiedlich definierten, konstanten Sequenzen (Primerbindungsorte) flankiert wird. Die ssDNA-Bibliothek stellt somit einen komplexen Pool von ca. 1015 verschiedenen Oligonukleotiden dar, der in der ersten SELEX-Runde direkt zum Einsatz kommt, und aus dem ?ber weitere, aufeinanderfolgende SELEX-Runden diejenigen Oligonukleotide (Aptamere) selektiert und angereichert werden, die besonders gut an das vorgegebene Zielmolek?l (z. B. Tau-Peptid) binden.

Eine SELEX-Runde besteht im Wesentlichen aus 5 Schritten. Zu Beginn einer Runde werden die Oligonukleotide in Bindungspuffer (100 mM NaCl, 20 mM Tris/HCl, pH 7.6, 2 mM MgCl2, 5 mM KCl, 1 mM CaCl2, 0,02% Tween20) zun?chst thermisch equilibriert (90?C 8 min, Eis 10 min, RT 3?6 min). Anschlie?end werden die Oligonukleotide sofort in einer Bindungsreaktion (Target-Selektionsschritt) zusammen mit dem Target, immobilisiert auf Magnetic Beads, inkubiert (21?C, 30 min, sch?tteln). Alle Oligonukleotide, welche nicht an das Target gebunden haben, werden dann in mehreren Waschschritten (Bindungspuffer) entfernt. Durch die Nutzung von Magnetic Beads zur Targetimmobilisierung sind eine effiziente Trennung der entstandenen Bindungskomplexe von den ungebundenen Oligonukleotiden sowie stringente Waschbedingungen m?glich. Danach erfolgt die Elution der an das Target gebundenen Oligonukleotide durch eine Hitzebehandlung (in Bindungspuffer, 80?C, 2 ? 7 min). Der n?chste Schritt umfa?t die Amplifikation der gesamten eluierten ssDNA mittels PCR. Dabei werden durch die Wahl 5'-modifizierter Primer einerseits eine Fluorescein-Markierung an den relevanten DNA-Strang angef?gt und andererseits der Gegenstrang durch einen HEGL-Spacer + zus?tzliche Nukleotide (dA20) verl?ngert. Diese Einf?hrung eines L?ngenunterschiedes zwischen beiden DNA-Str?ngen w?hrend der PCR erm?glicht im Anschlu? eine Reinigung der relevanten, nunmehr Fluorescein-markierten ssDNA aus den dsDNA-PCR-Produkten ?ber eine denaturierende PAGE. Auf diese Weise wird ein neuer, nun bereits selektierter Oligonukleotid-Pool generiert, welcher in der n?chsten SELEX-Runde mit frischen Target-modifizierten Magnetic Beads zur Bindung gebracht wird. Die Fluorescein-Markierung der Oligonukleotide erm?glicht ab der 2. SELEX-Runde die Quantifizierung der ssDNA in den einzelnen Schritten jeder Runde. Durch das Einf?hren zus?tzlicher Schritte in eine SELEX-Runde kann zus?tzlich Einflu? auf die Spezifit?t der zu selektierenden Aptamere genommen werden. Ein Negativ-Selektionsschritt kann der eigentlichen Bindungsreaktion vorgeschaltet werden. D. h. der Oligonukleotid-Pool wird beispielsweise mit unmodifizierten Magnetic Beads oder mit solchen, die dem Target verwandte Molek?le tragen, an die die Aptamere nicht binden sollen, inkubiert (21?C, 30 min, sch?tteln), um diejenigen (unerw?nschten) Oligonukleotide herauszusortieren, die an Oberfl?chen oder Molek?le binden, die nicht das Target sind. Alle hierbei nicht-bindenden Oligonukleotide werden dann direkt in die eigentliche Bindungsreaktion mit dem Selektionstarget gegeben. Dar?berhinaus kann ein Subtraktionsschritt nach der Elution Target-gebundener Oligonukleotide eingef?gt werden. D. h. der selektierte Oligonukleotid-Pool einer SELEX-Runde wird nochmals mit entsprechenden Magnetic Beads (siehe Negativ-Selektionsschritt) inkubiert (21?C, 30 min, sch?tteln), um alle unerw?nscht-bindenden Oligonukleotide zu entfernen. Die hierbei nicht-bindenden Oligonukleotide werden anschlie?end f?r die n?chste SELEX-Runde aufgearbeitet (Amplifikation, Reinigung).

Im vorliegenden Fall, der Selektion Tau-Peptid-spezifischer Aptamere, kamen zwei Varianten eines Tau-Peptids als Target zum Einsatz: Tau226-240 (SEQ ID No. 1) und die doppeltphosphorylierte Variante Tau226?240(2P). Die Peptide entsprechen der Aminos?ureposition 226?240 des humanen Tau-Proteins Isoform Tau-441 (Tau-F). Bei der phosphorylierten Variante wurde Threonin an Position 231 und Serin an Position 235 phosphoryliert. Beide Peptide bestehen aus 15 As und wurden am N-Terminus mit Biotin ?ber einen Aminohexans?ure-Spacer gekoppelt. Dies erm?glichte die Immobilisierung der Peptide an Streptavidin-Magnetic Beads (Tau226-StrepBeads bzw. Tau226(2P)-StrepBeads). Die Runden 1?7 wurden unter Verwendung von Tau226(2P)-StrepBeads (je 1 ? 108 Beads) durchgef?hrt, in den Runden 8?13 kamen Tau226-StrepBeads (je 1 ? 108 Beads) zur Anwendung. Dar?berhinaus wurden spezielle Beads im Neagtiv-Selektionsschritt bzw. Subtraktionsschritt eingesetzt, um unspezifisch bindende Oligonukleotide zu entfernen.

In jeder SELEX-Runde wurden zun?chst ein Negativ-Selektionsschritt und anschlie?end der eigentliche Target-Selektionsschritt durchgef?hrt. Die an die jeweils verwendeten Magnetic Beads gebundenen Oligonukleotide wurden nach mehreren Waschschritten durch eine Hitzebehandlung der Bindungskomplexe wieder von den Magnetic Beads eluiert und ab der 2. SELEX-Runde quantifiziert (Fluoreszenzmessung). Die Menge der eluierten Oligonukleotide aus jeder SELEX-Runde diente als Kriterium zur Bewertung des Selektionsverlaufes und ist in einem S?ulendiagramm in 2 dargestellt.

In den ersten sechs Runden wurde der SELEX-Prozess auf die doppeltphosphorylierte Peptidvariante Tau226?240(2P), immobilisiert auf Streptavidin-Magnetic Beads, als Zielmolek?l f?r die Aptamerselektion ausgerichtet. Im Negativ-Selektionsschritt wurden die unmodifizierten Beads verwendet. Dadurch konnte eine Anreicherung unspezifisch bindender Oligonukleotide verhindert werden. Die Ergebnisse zeigten aber auch, dass keine Oligonukleotide f?r das doppeltphosphorylierte Peptid Tau226?240(2P) angereichert werden konnten. Daraufhin wurden zur Kontrolle in Runde 7 die unmodifizierten Beads im Negativ-Selektionsschritt durch die Tau226-StrepBeads (unphosphorylierte Peptidvariante Tau226-240) ersetzt. Eine signifikante Menge ssDNA band an die Tau226-StrepBeads (Balken in Runde 7 im S?ulendiagramm 2). Damit zeigte sich, dass in den 6 SELEX-Runden ?berraschenderweise ein Oligonukleotid-Pool selektiert wurde, der an das unphosphorylierte Tau-Peptid binden kann, nicht jedoch an die phosphorylierte Variante. Wahrscheinlich waren gleichzeitig auch unphosphorylierte Varianten der Zielmolek?le, wenn auch in sehr geringer Menge, vorhanden. ?berraschenderweise haben sich hierf?r spezifisch bindende Oligonukleotide im Selektionsverlauf durchgesetzt. Nachdem dies erkannt worden war, wurde ab Runde 8 ein Targetwechsel vollzogen und der SELEX-Prozess auf die Selektion von Aptameren f?r das unphosphorylierte Tau-Peptid Tau226-240 ausgerichtet. In den folgenden sechs Runden konnte der Oligonukleotid-Pool weiter spezifiziert werden (siehe 2). Ab Runde 10 wurden im Negativ-Selektionsschritt weitere Beads mit unspezifischen Oberfl?chen verwendet. Zus?tzlich wurde in den Runden 10, 11 und 12 ein Subtraktionsschritt, ebenfalls mit diesen unspezifischen Beads, eingef?hrt. Beide Ma?nahmen dienten der Entfernung solcher Oligonukleotide aus dem selektierten Pool, die unspezifische Bindungen aufweisen. Nach der 13. SELEX-Runde wurde der SELEX-Prozess beendet und der selektierte Oligonukleotid-Pool anschlie?end kloniert. Insgesamt wurden 47 individuelle Aptamer-Klone charakterisiert. Nach Sequenzierung und Sequenzanalyse konnten diese 47 Aptamere aufgrund von Sequenzhomologien in 8 Gruppen eingeteilt werden, siehe Tabelle 1. Herausragend war die Gruppe 1. Sie enthielt mit 29 Aptamer-Klonen die meisten Vertreter. Die anderen Gruppen enthielten 3?6 Vertreter oder stellten Einzelklone dar. Eine gruppen?bergreifende Konsensussequenz konnte nicht identifiziert werden. In der Gruppe 2 wurden alle Aptamer-Klone zusammengefasst, die intern vollst?ndige bzw. teilweise Wiederholungen der 3'-Primerbindungsregion enthalten. Da die Primerbindungsregionen in allen Aptameren methodisch-bedingt vorhanden sind, k?nnten die Aptamere der Gruppe 2 m?glicherweise PCR-Artefakte darstellen.

Bindungsstudien mit individuellen Aptameren

Erste vergleichende Bindungsstudien mit einzelnen Aptamer-Klonen wurden entsprechend den SELEX-Bedingungen durchgef?hrt. In einer Bindungsreaktion wurden Tau226-StrepBeads (je 1 ? 107) und Fluorescein-markierte ssDNA eines Aptamer-Klones (13?16 pmol, nach thermischer Equilibrierung) zusammengegeben und inkubiert (21?C, 30 min, sch?tteln; Bindungspuffer). Anschlie?end erfolgten mehrere Waschschritte, um alle ungebundenen Aptamere zu entfernen. Die Target-gebundenen Aptamere wurden durch eine Hitzebehandlung (in Bindungspuffer, 80?C, 2 ? 7 min) wieder von den Tau226-StrepBeads eluiert. Durch die Fluoresceinmarkierung der ssDNA konnten die Aptamere im Eluat gemessen und ?ber eine Eichkurve quantifiziert werden. Die Ergebnisse sind in einem S?ulendiagramm in 3 dargestellt.

F?r die vergleichenden Bindungsstudien wurde je ein Vertreter der 8 Aptamer-Gruppen eingesetzt, au?erdem der selektierte Aptamer-Pool und die unselektierte ssDNA-Bibliothek. Der selektierte Aptamer-Pool zeigte erwartungsgem?? das h?chste Bindungsverm?gen, w?hrend das Bindungsverhalten der einzelnen Aptamer-Klone sehr unterschiedlich ausfiel. Die Klone #1/2 (Gr. 2), #11/44 (Gr. 3) und #11/42 (Gr. 7) zeigten ein geringes Bindungsverm?gen. Die Klone #11/34 (Cr. 1) und #3/21 (Cr. 6) waren in ihrem Bindungsverm?gen etwa vergleichbar mit der unselektierten ssDNA-Bibliothek. Ein besseres Bindungsverm?gen zeigten die Klone #3/22 (Cr. 4), #1/5 (Gr. 5) und insbesondere #5/60 (Gr. 8).

Vom Aptamer-Klon #5/60, als bester Binder gem?? der bisherigen Bindungstudien, wurde eine S?ttigungskurve aufgenommen und der KD-Wert als ein Ma? f?r die Affinit?t des Aptamers zu seinem Target bestimmt, siehe 4. In mehreren Bindungsans?tzen wurde die Aptamer-DNA in aufsteigender Konzentration (in einem Bereich von 5?200 pmol/ml) mit Tau226-StrepBeads (konstante Beadzahl von 1 ? 107) zur Bindung zusammengegeben. Die Versuchsbedingungen entsprachen denen der oben beschriebenen vergleichenden Bindungsstudien. ?ber eine Nichtlineare Regressionsanalyse der Bindungsdaten konnte ein KD-Wert von 76 nM (?9,6 nM) f?r das Aptamer #5/60 ermittelt werden.

Es folgt ein Sequenzprotokoll nach WIPO St. 25.Dieses kann von der amtlichen Ver?ffentlichungsplattform des DPMA heruntergeladen werden.

ZITATE ENTHALTEN IN DER BESCHREIBUNG

Diese Liste der vom Anmelder aufgef?hrten Dokumente wurde automatisiert erzeugt und ist ausschlie?lich zur besseren Information des Lesers aufgenommen. Die Liste ist nicht Bestandteil der deutschen Patent- bzw. Gebrauchsmusteranmeldung. Das DPMA ?bernimmt keinerlei Haftung f?r etwaige Fehler oder Auslassungen.

Zitierte Nicht-Patentliteratur

  • K. Bracht in ?Indikatoren f?r Diagnose und Therapie?; Pharmazeutische Zeitung online Ausgabe 12/2009; http://www.pharmazeutische-zeitung.de/index.php?id=29346&type=0 [0003]
  • Hort et al., ?Bedeutung der Gesamt-Tau und Phospho-Tau-Protein-Liquorspiegel in der Demenzdiagnostik?, Nervenarzt 2008, 79, 891?898 [0006]
  • http://blast.ncbi.nlm.nih.gov/Blast.cgi [0028]
  • Tuerk & Gold, Science 249 (1990) 505?510, sowie Ellington & Szostak, Nature 346 (1990) 818?822 [0029]
  • Stoltenburg et al., ?FluMag-SELEX as an advantageous method for DNA aptamer selection?, Anal Bioanal Chem. 2005; 383(1): 83?91 [0076]