|
Match
|
Document |
Document Title |
|
|
7560265 |
Compositions for regulation of tumor necrosis factor-alpha
The present invention relates to compositions relating a nucleic acid encoding an interleukin 18-inducible cytokine termed tumor necrosis factor-alpha inducing factor (TAIF) or interleukin-32...
|
|
|
7560230 |
Method for determining susceptibility of tumor to treatment with anti-neoplastic agent
The level of one or more glucose transporters in a sample containing cancer cells is measured and compared to a reference value to determine whether the cancer is susceptible to treatment with an...
|
|
|
7560108 |
Anti-TNFα antibodies
Novel TNFα antibody polypeptides and nucleic acids are disclosed. Methods of utilizing the polypeptides to treat TNFα-related diseases are also disclosed.
|
|
|
7560541 |
Heart20049410 full-length cDNA and polypeptides
Novel full-length cDNAs are provided. cDNA derived from human have been isolated. The full-length nucleotide sequences of the cDNA and amino acid sequences encoded by the nucleotide sequences have...
|
|
|
7556938 |
Nucleic acids encoding potassium channel interactors
The invention provides isolated nucleic acids molecules, designated PCIP nucleic acid molecules, which encode proteins that bind potassium channels and modulate potassium channel mediated...
|
|
|
7556941 |
Materials and methods for preparing dimeric growth factors
Proteins consisting of, from amino to carboxyl terminus, a first PDGF-D growth factor domain polypeptide, a linker polypeptide, and a second PDGF-D growth factor domain polypeptide, and materials...
|
|
|
7556955 |
Nucleic acids encoding Candida kefyr cytosine deaminase
A new cytosine deaminase gene and protein from Candida kefyr are provided. This protein has increased ability to convert the 5-fluorocytosine prodrug to its toxic form when compared against the ...
|
|
|
7556963 |
Feline IL-18 nucleic acid molecules
The present invention relates to canine and feline proteins. In particular, the present invention discloses feline interleukin-18, feline caspase-1, feline interleukin-12 single chain and canine...
|
|
|
7550300 |
Prediction of bare metal stent restenosis
Methods for predicting whether or not a patient is likely to experience restenosis after the placement of a bare metal stent are provided. The methods involve detecting and analyzing gene...
|
|
|
7550293 |
Chimeric nicotinic receptor subunits
A chimeric nAChR receptor subunit polypeptide having a substitution of at least about 15% of the native amino acid sequence of the subunit in the area of the C-terminal cytoplasmic domain is...
|
|
|
7550262 |
PTPN11 (SHP-2) mutations and cancer
Diagnostic and therapeutic applications for certain types of cancer and precancerous conditions, including those deriving from hematologic cells, are described. Of particular interest are those...
|
|
|
7550263 |
Method for the production of fusion proteins in transgenic mammal milk
Desirable fusion proteins can be produced in and purified from the milk of transgenic animals. The peptides are made as fusion proteins with a suitable fusion partner such as human...
|
|
|
7550574 |
Nucleic acids and proteins of insect Or83b odorant receptor genes and uses thereof
The present invention relates to insect odorant receptor genes and methods for identifying odorant receptor genes. The invention provides nucleotide sequences of insect odorant receptor genes...
|
|
|
7550566 |
G-CSF conjugates
Polypeptide conjugates with G-CSF activity comprising a polypeptide having at least one introduced lysine residue and at least one removed lysine residue compared to the sequence of human G-CSF,...
|
|
|
7547821 |
Methods for the production of insulin in plants
Commercial production of human insulin can be affected via transgenic expression in plant seeds. Thus, levels of insulin accumulation exceeding 0.1% of total cellular protein can be achieved...
|
|
|
7544491 |
TANGO 240 nucleic acids and uses thereof
The invention provides isolated nucleic acid molecules, designated TANGO 228 nucleic acid molecules, which encode secreted proteins with homology to the rat MCA-32 protein, isolated nucleic acid...
|
|
|
7544481 |
Nucleic acids encoding CD40 binding protein
This invention provides a novel purified mammalian protein having the ability to bind the cytoplasmic region or domain of a CD40 receptor and the nucleic acid molecules coding for this protein....
|
|
|
7544492 |
OB polypeptides, modified forms and derivatives
The present invention relates generally to the control of body weight of animals including mammals and humans, and more particularly to materials identified herein as modulators of weight, and to...
|
|
|
7544485 |
Baldness related gene and the polypeptide encoded thereby, and uses
The invention has disclosed a baldness-related gene and the encoded polypeptide, and a process for producing the polypeptide by recombinant methods. It has also disclosed the use of Rhor gene and...
|
|
|
7544789 |
DNA encoding Toxoplasma gondii rDGP5p protein
Recombinant proteins have been developed for the detection of Toxoplasma gondii oocyst proteins for example in biological fluids. Isolated DNA sequences which encode these proteins have also been...
|
|
|
7544670 |
HoxD3, HoxA3 and HoxB3 compositions and methods for improved wound healing
The present invention provides methods and compositions useful in localized transfer of genetic material or proteins. Moreover, the present invention provides methods and compositions for improving...
|
|
|
7544482 |
Nucleic acids encoding receptor for IL-17 homologous polypeptides and uses thereof
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
|
|
|
7544486 |
Nell peptide expression systems and bone formation activity of nell peptide
The invention generally relates to a bone growth factor, and more particularly to compositions including NELL1, articles of manufacture including NELL1 and methods of using NELL1 to induce bone...
|
|
|
7544776 |
Long wavelength engineered fluorescent proteins
Engineered fluorescent proteins, nucleic acids encoding them and methods of use.
|
|
|
7544788 |
Isolated nucleic acid molecule encoding a neurotrophic growth factor
There is disclosed an isolated nucleic acid molecule encoding a human neurotrophic growth factor designated enovin and having the amino acid sequence illustrated in FIG. 1, 21, 23 or 24 or...
|
|
|
7541435 |
Antagonists of cxcr3-binding cxc chemokines
Novel antagonists of CXCR3-binding CXC chemokines, and in particular of human CXCL11, can be obtained by generating mutants of such chemokines in which the binding to glycosaminoglycans (GAGs) is...
|
|
|
7541035 |
Immunogenic peptides for the treatment of prostate and breast cancer
Immunogenic T-cell receptor gamma Alternate Reading Frame Protein (TARP) polypeptides are disclosed herein. These immunogenic TARP polypeptides include nine consecutive amino acids of the amino...
|
|
|
7537928 |
Mutations in ion channel proteins associated with sudden cardiac death
Previously unknown mutations of the KCNH2, SCN5A and KCNQ1 genes are disclosed which are involved in ion channel disruptions associated with short QT syndrome, long QT syndrome, Brugada syndrome...
|
|
|
7537893 |
Mitochondrial ND5 gene mutations in Parkinson's disease
The present invention provides methods for diagnosing and treating Parkinson's disease based on mitochondrial mutations. The present invention also provides methods for diagnosing and treating...
|
|
|
7537763 |
Anti-CD40 monoclonal antibody
An antibody or a functional fragment thereof, acting agonistically or antagonistically on CD40.
|
|
|
7534585 |
Multifunctional cytokines
The present invention relates to a novel fusion protein with the formula X—Y, or Y—X, wherein X represents a first immunoregulating polypeptide and Y represents a second immunoregulating...
|
|
|
7534875 |
Compositions for glioma classification
The present invention provides novel compositions and their use in classifying gliomas. In a preferred embodiment, the methods are used to discriminate between oligodendroglioma and glioblastoma.
|
|
|
7534874 |
Gene involved in V(D)J recombination and/or DNA repair
The invention related to a new gene and protein involved in V(D)J recombination and/or DNA repair. The invention also relates to methods of diagnosis and therapy using these gene and protein. The...
|
|
|
7534604 |
Fusion polypeptides capable of activating receptors
A fusion polypeptide comprising (A) x -M-(A′) y , wherein A and A′ are each polypeptides capable of binding a target receptor. The fusion polypeptides of the invention form multimeric proteins...
|
|
|
7531523 |
Sodium channel protein type III alpha-subunit splice variant
The present invention is directed to a splice variant of a human sodium channel alpha subunit and methods and compositions for making and using the same.
|
|
|
7531321 |
Fibroblast growth factor-like molecules and uses thereof
The present invention provides Fibroblast Growth Factor-Like (FGF-L) polypeptides and nucleic acid molecules encoding the same. The invention also provides selective binding agents, vectors, host...
|
|
|
7531509 |
Papillosin antimicrobial peptide, a gene coding said peptide, a vector, a transformed organism and a compound containing said organism
An antimicrobial peptide isolated from an extract from a marine invertebrate, whose amino acid sequence is as follows:
GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ (SEQ ID No. 1), its derivatives, its...
|
|
|
7531326 |
Chimeric retinoid X receptors and their use in a novel ecdysone receptor-based inducible gene expression system
This invention relates to the field of biotechnology or genetic engineering. Specifically, this invention relates to the field of gene expression. More specifically, this invention relates to a...
|
|
|
7531311 |
Methods of detecting or diagnosing inflammatory bowel disease using prokineticin polynucleotides
The present invention provides methods of using Zven1 and Zven2 polypeptides to increase chemokine production. The present invention also provides methods of using antagonists to Zven1 and Zven2 to...
|
|
|
7527944 |
Taste receptors of the T1R family from domestic cat
The present invention relates to the discovery of several genes of the domestic cat ( Felis catus ) associated with taste perception. The invention provides, inter alia, the nucleotide sequence of...
|
|
|
7527946 |
Interferon-beta-1a-immunoglobulin fusion proteins and uses
A fusion polypeptide is described having the amino acid sequence X-Y-Z, or portion thereof, comprising the amino acid sequence of a glycosylated interferon-beta (X); Y is an optional linker moiety;...
|
|
|
7528244 |
Regulators of apoptosis
The invention provides methods and compositions relating to apoptosis regulating proteins, known as Casper proteins, and related nucleic acids. The proteins may be produced recombinantly from...
|
|
|
7524944 |
Chimeric nucleic acids encoding polypeptides comprising CD154 and TNF-α
This invention relates to genes which encode accessory molecule ligands and their use for immunomodulation, vaccination and treatments of various human diseases, including malignancies and...
|
|
|
7524680 |
Polyampholytes for delivering polyions to a cell
An polyampholyte is utilized in a condensed polynucleotide complex for purposes of nucleic acid delivery to a cell. The complex can be formed with an appropriate amount of positive and/or negative...
|
|
|
7524505 |
Compositions and methods for dual therapies of hair graying and balding in follicular delivery systems
The present invention provides comprehensive compositions for treating problems associated with hair graying and balding via the incorporation of: (i) the cell growth factor of HSCF to induce the...
|
|
|
7521537 |
Cytokine receptor zcytor17
Novel polypeptides, polynucleotides encoding the polypeptides, and related compositions and methods are disclosed for zcytor17, a novel cytokine receptor. The polypeptides may be used within...
|
|
|
7521536 |
Glutamate transporter associated protein
Glutamate Transporter Associated Proteins and nucleotide encoding Glutamate Transporter Associated Proteins are provided. Also provided is a method for identifying a compound that modulates a...
|
|
|
7521207 |
Rhesus monkey Nur77
The Macaca mulatta (rhesus monkey) Nur77 (rhNur77) nuclear receptor and the nucleic acid encoding the rhNur77 nuclear receptor are described. Further described are methods for identifying...
|
|
|
7521208 |
Vectors encoding interleukin-17 receptor homologue
Cytokines and their receptors have proven usefulness in both basic research and as therapeutics. The present invention provides a new human cytokine receptor designated as “Zcytor14.”
|
|
|
7521205 |
Genes and polypeptides relating to prostate cancers
The present application provides novel human gene MICAL2-PV whose expression is markedly elevated in prostate cancers. Furthermore, it provides polypeptides encoded by the gene as well as...
|