Match Document Document Title
7560265 Compositions for regulation of tumor necrosis factor-alpha  
The present invention relates to compositions relating a nucleic acid encoding an interleukin 18-inducible cytokine termed tumor necrosis factor-alpha inducing factor (TAIF) or interleukin-32...
7560230 Method for determining susceptibility of tumor to treatment with anti-neoplastic agent  
The level of one or more glucose transporters in a sample containing cancer cells is measured and compared to a reference value to determine whether the cancer is susceptible to treatment with an...
7560108 Anti-TNFα antibodies  
Novel TNFα antibody polypeptides and nucleic acids are disclosed. Methods of utilizing the polypeptides to treat TNFα-related diseases are also disclosed.
7560541 Heart20049410 full-length cDNA and polypeptides  
Novel full-length cDNAs are provided. cDNA derived from human have been isolated. The full-length nucleotide sequences of the cDNA and amino acid sequences encoded by the nucleotide sequences have...
7556938 Nucleic acids encoding potassium channel interactors  
The invention provides isolated nucleic acids molecules, designated PCIP nucleic acid molecules, which encode proteins that bind potassium channels and modulate potassium channel mediated...
7556941 Materials and methods for preparing dimeric growth factors  
Proteins consisting of, from amino to carboxyl terminus, a first PDGF-D growth factor domain polypeptide, a linker polypeptide, and a second PDGF-D growth factor domain polypeptide, and materials...
7556955 Nucleic acids encoding Candida kefyr cytosine deaminase  
A new cytosine deaminase gene and protein from Candida kefyr are provided. This protein has increased ability to convert the 5-fluorocytosine prodrug to its toxic form when compared against the ...
7556963 Feline IL-18 nucleic acid molecules  
The present invention relates to canine and feline proteins. In particular, the present invention discloses feline interleukin-18, feline caspase-1, feline interleukin-12 single chain and canine...
7550300 Prediction of bare metal stent restenosis  
Methods for predicting whether or not a patient is likely to experience restenosis after the placement of a bare metal stent are provided. The methods involve detecting and analyzing gene...
7550293 Chimeric nicotinic receptor subunits  
A chimeric nAChR receptor subunit polypeptide having a substitution of at least about 15% of the native amino acid sequence of the subunit in the area of the C-terminal cytoplasmic domain is...
7550262 PTPN11 (SHP-2) mutations and cancer  
Diagnostic and therapeutic applications for certain types of cancer and precancerous conditions, including those deriving from hematologic cells, are described. Of particular interest are those...
7550263 Method for the production of fusion proteins in transgenic mammal milk  
Desirable fusion proteins can be produced in and purified from the milk of transgenic animals. The peptides are made as fusion proteins with a suitable fusion partner such as human...
7550574 Nucleic acids and proteins of insect Or83b odorant receptor genes and uses thereof  
The present invention relates to insect odorant receptor genes and methods for identifying odorant receptor genes. The invention provides nucleotide sequences of insect odorant receptor genes...
7550566 G-CSF conjugates  
Polypeptide conjugates with G-CSF activity comprising a polypeptide having at least one introduced lysine residue and at least one removed lysine residue compared to the sequence of human G-CSF,...
7547821 Methods for the production of insulin in plants  
Commercial production of human insulin can be affected via transgenic expression in plant seeds. Thus, levels of insulin accumulation exceeding 0.1% of total cellular protein can be achieved...
7544491 TANGO 240 nucleic acids and uses thereof  
The invention provides isolated nucleic acid molecules, designated TANGO 228 nucleic acid molecules, which encode secreted proteins with homology to the rat MCA-32 protein, isolated nucleic acid...
7544481 Nucleic acids encoding CD40 binding protein  
This invention provides a novel purified mammalian protein having the ability to bind the cytoplasmic region or domain of a CD40 receptor and the nucleic acid molecules coding for this protein....
7544492 OB polypeptides, modified forms and derivatives  
The present invention relates generally to the control of body weight of animals including mammals and humans, and more particularly to materials identified herein as modulators of weight, and to...
7544485 Baldness related gene and the polypeptide encoded thereby, and uses  
The invention has disclosed a baldness-related gene and the encoded polypeptide, and a process for producing the polypeptide by recombinant methods. It has also disclosed the use of Rhor gene and...
7544789 DNA encoding Toxoplasma gondii rDGP5p protein  
Recombinant proteins have been developed for the detection of Toxoplasma gondii oocyst proteins for example in biological fluids. Isolated DNA sequences which encode these proteins have also been...
7544670 HoxD3, HoxA3 and HoxB3 compositions and methods for improved wound healing  
The present invention provides methods and compositions useful in localized transfer of genetic material or proteins. Moreover, the present invention provides methods and compositions for improving...
7544482 Nucleic acids encoding receptor for IL-17 homologous polypeptides and uses thereof  
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
7544486 Nell peptide expression systems and bone formation activity of nell peptide  
The invention generally relates to a bone growth factor, and more particularly to compositions including NELL1, articles of manufacture including NELL1 and methods of using NELL1 to induce bone...
7544776 Long wavelength engineered fluorescent proteins  
Engineered fluorescent proteins, nucleic acids encoding them and methods of use.
7544788 Isolated nucleic acid molecule encoding a neurotrophic growth factor  
There is disclosed an isolated nucleic acid molecule encoding a human neurotrophic growth factor designated enovin and having the amino acid sequence illustrated in FIG. 1, 21, 23 or 24 or...
7541435 Antagonists of cxcr3-binding cxc chemokines  
Novel antagonists of CXCR3-binding CXC chemokines, and in particular of human CXCL11, can be obtained by generating mutants of such chemokines in which the binding to glycosaminoglycans (GAGs) is...
7541035 Immunogenic peptides for the treatment of prostate and breast cancer  
Immunogenic T-cell receptor gamma Alternate Reading Frame Protein (TARP) polypeptides are disclosed herein. These immunogenic TARP polypeptides include nine consecutive amino acids of the amino...
7537928 Mutations in ion channel proteins associated with sudden cardiac death  
Previously unknown mutations of the KCNH2, SCN5A and KCNQ1 genes are disclosed which are involved in ion channel disruptions associated with short QT syndrome, long QT syndrome, Brugada syndrome...
7537893 Mitochondrial ND5 gene mutations in Parkinson's disease  
The present invention provides methods for diagnosing and treating Parkinson's disease based on mitochondrial mutations. The present invention also provides methods for diagnosing and treating...
7537763 Anti-CD40 monoclonal antibody  
An antibody or a functional fragment thereof, acting agonistically or antagonistically on CD40.
7534585 Multifunctional cytokines  
The present invention relates to a novel fusion protein with the formula X—Y, or Y—X, wherein X represents a first immunoregulating polypeptide and Y represents a second immunoregulating...
7534875 Compositions for glioma classification  
The present invention provides novel compositions and their use in classifying gliomas. In a preferred embodiment, the methods are used to discriminate between oligodendroglioma and glioblastoma.
7534874 Gene involved in V(D)J recombination and/or DNA repair  
The invention related to a new gene and protein involved in V(D)J recombination and/or DNA repair. The invention also relates to methods of diagnosis and therapy using these gene and protein. The...
7534604 Fusion polypeptides capable of activating receptors  
A fusion polypeptide comprising (A) x -M-(A′) y , wherein A and A′ are each polypeptides capable of binding a target receptor. The fusion polypeptides of the invention form multimeric proteins...
7531523 Sodium channel protein type III alpha-subunit splice variant  
The present invention is directed to a splice variant of a human sodium channel alpha subunit and methods and compositions for making and using the same.
7531321 Fibroblast growth factor-like molecules and uses thereof  
The present invention provides Fibroblast Growth Factor-Like (FGF-L) polypeptides and nucleic acid molecules encoding the same. The invention also provides selective binding agents, vectors, host...
7531509 Papillosin antimicrobial peptide, a gene coding said peptide, a vector, a transformed organism and a compound containing said organism  
An antimicrobial peptide isolated from an extract from a marine invertebrate, whose amino acid sequence is as follows: GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ (SEQ ID No. 1), its derivatives, its...
7531326 Chimeric retinoid X receptors and their use in a novel ecdysone receptor-based inducible gene expression system  
This invention relates to the field of biotechnology or genetic engineering. Specifically, this invention relates to the field of gene expression. More specifically, this invention relates to a...
7531311 Methods of detecting or diagnosing inflammatory bowel disease using prokineticin polynucleotides  
The present invention provides methods of using Zven1 and Zven2 polypeptides to increase chemokine production. The present invention also provides methods of using antagonists to Zven1 and Zven2 to...
7527944 Taste receptors of the T1R family from domestic cat  
The present invention relates to the discovery of several genes of the domestic cat ( Felis catus ) associated with taste perception. The invention provides, inter alia, the nucleotide sequence of...
7527946 Interferon-beta-1a-immunoglobulin fusion proteins and uses  
A fusion polypeptide is described having the amino acid sequence X-Y-Z, or portion thereof, comprising the amino acid sequence of a glycosylated interferon-beta (X); Y is an optional linker moiety;...
7528244 Regulators of apoptosis  
The invention provides methods and compositions relating to apoptosis regulating proteins, known as Casper proteins, and related nucleic acids. The proteins may be produced recombinantly from...
7524944 Chimeric nucleic acids encoding polypeptides comprising CD154 and TNF-α  
This invention relates to genes which encode accessory molecule ligands and their use for immunomodulation, vaccination and treatments of various human diseases, including malignancies and...
7524680 Polyampholytes for delivering polyions to a cell  
An polyampholyte is utilized in a condensed polynucleotide complex for purposes of nucleic acid delivery to a cell. The complex can be formed with an appropriate amount of positive and/or negative...
7524505 Compositions and methods for dual therapies of hair graying and balding in follicular delivery systems  
The present invention provides comprehensive compositions for treating problems associated with hair graying and balding via the incorporation of: (i) the cell growth factor of HSCF to induce the...
7521537 Cytokine receptor zcytor17  
Novel polypeptides, polynucleotides encoding the polypeptides, and related compositions and methods are disclosed for zcytor17, a novel cytokine receptor. The polypeptides may be used within...
7521536 Glutamate transporter associated protein  
Glutamate Transporter Associated Proteins and nucleotide encoding Glutamate Transporter Associated Proteins are provided. Also provided is a method for identifying a compound that modulates a...
7521207 Rhesus monkey Nur77  
The Macaca mulatta (rhesus monkey) Nur77 (rhNur77) nuclear receptor and the nucleic acid encoding the rhNur77 nuclear receptor are described. Further described are methods for identifying...
7521208 Vectors encoding interleukin-17 receptor homologue  
Cytokines and their receptors have proven usefulness in both basic research and as therapeutics. The present invention provides a new human cytokine receptor designated as “Zcytor14.”
7521205 Genes and polypeptides relating to prostate cancers  
The present application provides novel human gene MICAL2-PV whose expression is markedly elevated in prostate cancers. Furthermore, it provides polypeptides encoded by the gene as well as...