|
Match
|
Document |
Document Title |
|
|
7538202 |
Enzyme-free isothermal exponential amplification of nucleic acids and nucleic acid analog signals
An enzyme-free, isothermal method of generating an amplification signal indicative of a target nucleic acid molecule is provided, as are compositions for performing such a method. An advantage of...
|
|
|
7538210 |
Sucrose-inducible promoter from sweetpotato
Disclosed herein are a novel sucrose-inducible promoter sequence and a 5′ untranslated region which are derived from sweetpotato ADP-glucose pyrophosphorlyase gene (ibAGP1) (SEQ ID NO: 1). Also...
|
|
|
7537893 |
Mitochondrial ND5 gene mutations in Parkinson's disease
The present invention provides methods for diagnosing and treating Parkinson's disease based on mitochondrial mutations. The present invention also provides methods for diagnosing and treating...
|
|
|
7538206 |
Comparative mycobacterial geneomics as a tool for identifying targets for the diagnosis, prophylaxis or treatment of mycobacterioses
The present invention is directed to a method of selection of purified nucleotidic sequences or polynucleotides encoding proteins or part of proteins carrying at least an essential function for the...
|
|
|
7537892 |
Method and sequences for determinate nucleic acid hybridization
Provided are methods for using nucleic acid sequences having two or more degenerately pairing nucleotides, each degenerate nucleotide having a partially overlapping set of complementarity, to...
|
|
|
7538201 |
Recombinant herpesvirus and uses thereof
A recombinant herpesvirus (excluding infectious laryngotracheitis virus) having a DNA that encodes a polypeptide comprising 429 amino acids at the amino terminal end of a protein encoded by the gB...
|
|
|
7537895 |
Comparative genomic hybridization
Disclosed are new methods comprising the use of in situ hybridization to detect abnormal nucleic acid sequence copy numbers in one or more genomes wherein repetitive sequences that bind to multiple...
|
|
|
7537929 |
Genes for male accessory gland proteins in Drosophila melanogaster
The present invention provides a number of accessory gland proteins from Drosophila . The invention also provides an accessory gland protein which is toxic to insect cells and can be used to kill...
|
|
|
7538208 |
Type III secretion pathway in Aeromonas salmonicida, and uses therefor
Disclosed is a newly identified and characterized type III secretion system in Aeromonas salmonicida . The invention also encompasses the use of components of the novel secretion system in...
|
|
|
7538207 |
Polyepitope carrier protein
The invention relates to polyepitope carrier proteins that comprise at least five CD4+T cell epitopes, for conjugation to capsular polysaccharides. The carrier proteins are use useful as components...
|
|
|
7538200 |
Thermal tolerant avicelase from Acidothermus cellulolyticus
The invention provides a thermal tolerant (thermostable) cellulase, AviIII, that is a member of the glycoside hydrolase (GH) family. AviIII was isolated and characterized from Acidothermus...
|
|
|
7534445 |
Chlamydia protein, sequence and uses thereof
A high molecular weight (“HMW”) protein of chlamydia , the amino acid sequence thereof, and antibodies that specifically bind the HMW protein are disclosed as well as the nucleic acid sequence...
|
|
|
7534878 |
Composition and methods of RNAi therapeutics for treatment of cancer and other neovascularization diseases
Compositions and methods are provided for treatment of diseases involving unwanted neovascularization (NV). The invention provides treatments that control NV through selective inhibition of...
|
|
|
7534621 |
Method of producing probe medium and method of immobilizing probe using probe medium
When a probe medium is spotted on a substrate, a probe can be effectively and stably immobilized on the substrate. The probe medium includes a probe capable of specifically binding to a target...
|
|
|
7534564 |
Methods and compositions for polypeptide engineering
Methods are provided for the evolution of proteins of industrial and pharmaceutical interest, including methods for effecting recombination and selection. Compositions produced by these methods are...
|
|
|
7534560 |
Simple catalytic DNA biosensors for ions based on color changes
Disclosed are compositions and methods for the sensitive and selective detection of ions using nucleic acid enzymes and DNA modified microparticles.
|
|
|
7534931 |
Method for producing modified starch
A method for modifying plants by manipulating the activity of a combination of plant enzymes having starch synthase activity, in particular starch synthase II (SSII) and starch synthase III...
|
|
|
7534875 |
Compositions for glioma classification
The present invention provides novel compositions and their use in classifying gliomas. In a preferred embodiment, the methods are used to discriminate between oligodendroglioma and glioblastoma.
|
|
|
7534873 |
Method and materials for quaternary amine catalyzed bisulfite conversion of cytosine to uracil
The invention provides methods and materials for the conversion of cytosine to uracil. A nucleic acid, such a gDNA, is reacted with bisulfate, such as magnesium bisulfite, in the presence of a...
|
|
|
7534775 |
Methods and compositions for modulating cardiac contractility
Methods and compositions are provided for modulating cardiac contractility by regulating transcription of the phsopholamban gene using engineered zinc finger proteins.
|
|
|
7534872 |
Compositions and methods for the use of FMOC derivatives in DNA/RNA synthesis
Methods of nucleic acid preparation are described, including preparation of mRNA, using FMOC derivatives to synthesize oligonucleotides in addition to applying FMOC protocols to various therapeutic...
|
|
|
7534932 |
Root-specific phosphate transporter promoters
The current invention provides plant promoter sequences. Compositions comprising the promoter sequence are described, as are methods for the expression of transgenes in plants comprising the use of...
|
|
|
7534561 |
Nucleic acid array in situ fabrication methods and arrays produced using the same
Methods and devices for producing a nucleic acid arrays using in situ nucleic acid array synthesis protocols are provided. A feature of certain embodiments of the invention is that control probes...
|
|
|
7534568 |
Methods for detection of a target nucleic acid by forming a cleavage structure with a cleavage resistant probe
The invention relates to compositions and methods for generating a signal indicative of the presence of a target nucleic acid in a sample utilizing a cleavage resistant probe.
|
|
|
7534874 |
Gene involved in V(D)J recombination and/or DNA repair
The invention related to a new gene and protein involved in V(D)J recombination and/or DNA repair. The invention also relates to methods of diagnosis and therapy using these gene and protein. The...
|
|
|
7534449 |
Targeted and high density drug loaded polymeric materials
Polymeric delivery devices have been developed which combine high loading/high density of molecules to be delivered with the option of targeting. As used herein, “high density” refers to...
|
|
|
7534569 |
Method of generating long nucleic acid molecules of defined sequence
A method of generating a single-stranded nucleic acid molecule comprising (a) combining in a mixture under conditions suitable for a polymerase extension reaction, (i) a polymerase, (ii) an initial...
|
|
|
7534565 |
DLC-1 gene deleted in cancers
A cDNA molecule corresponding to a newly discovered human gene is disclosed. The new gene, which is frequently deleted in liver cancer cells and cell lines, is called the DLC-1 gene. Because the...
|
|
|
7534566 |
Nucleic acid labeling method and liquid composition
It is provided a nucleic acid labeling method that can reduce to a minimum the amount of a labeling substance used and can effectively incorporate the labeling substance into a product, a target...
|
|
|
7534587 |
Microsatellite markers for plants of the genus Triticeae and use thereof
The invention relates to novel microsatellite markers for wheats ( Triticum aestivum ) and closely related species (Genus Triticeae ) and to the use of said markers for the genetic analysis of...
|
|
|
7531717 |
Regulatory genes involved in condensed tannin synthesis in plants
The present invention provides two novel regulatory genes and encoded proteins which can be used to alter the biosynthesis and accumulation of condensed tannin levels in plants and plant tissues....
|
|
|
7531626 |
Tenebrio antifreeze proteins
A novel class of thermal hysteresis (antifreeze) proteins (THP) that have up to 100 times the specific activity of fish antifreeze proteins has been isolated and purified from the mealworm beetle, ...
|
|
|
7531647 |
Lentiviral vectors for site-specific gene insertion
Murine leukemia virus (MLV) and lentivirus vectors have been used previously to deliver genes to hematopoietic stem cells (HSCs) in human gene therapy trials. However, these vectors integrate...
|
|
|
7531714 |
Melusin a muscle specific protein, as a drug target for prevention and treatment of heart failure
The present invention concerns non-human transgenic animals as model study for human pathologies, being transgenic for having altered melusin expression. The non-human transgenic animals are to be...
|
|
|
7531332 |
Method for producing a lower alkyl ester of α-L-aspartyl-L-phenylalanine using Escherichia bacteria
A method for producing an L-amino acid, such as L-phenylalanine and L-threonine, is provided using an Escherichia bacterium, wherein the L-amino acid productivity of said bacterium is enhanced by...
|
|
|
7531317 |
Fluorescence polarization assay to detect protease cleavage
The invention discloses a method of determining protease activity, in real time, using fluorescence polarization technology. In particular, the invention provides vectors and a method for their...
|
|
|
7531305 |
Human Papilloma Virus detection with DNA microarray
A method is provided of detecting the presence of HPV comprising the following steps: a. amplification and labelling part of the E1 HPV gene, in particular its 3′ end; b. hydrizing the labelled...
|
|
|
7531726 |
Controlled alignment of nanobarcodes encoding specific information for scanning probe microscopy (SPM) reading
The methods, apparatus and compositions disclosed herein concern the detection, identification and/or sequencing of biomolecules, such as nucleic acids or proteins. In certain embodiments of the...
|
|
|
7531509 |
Papillosin antimicrobial peptide, a gene coding said peptide, a vector, a transformed organism and a compound containing said organism
An antimicrobial peptide isolated from an extract from a marine invertebrate, whose amino acid sequence is as follows:
GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ (SEQ ID No. 1), its derivatives, its...
|
|
|
7531326 |
Chimeric retinoid X receptors and their use in a novel ecdysone receptor-based inducible gene expression system
This invention relates to the field of biotechnology or genetic engineering. Specifically, this invention relates to the field of gene expression. More specifically, this invention relates to a...
|
|
|
7531649 |
Aptamers to human epidermal growth factor receptor-3
The disclosure provided herein provides compositions of nucleic acid aptamers that bind human epidermal growth factor receptor-3 and methods for their use.
|
|
|
7531524 |
Modulators of coagulation factors with enhanced stability
The invention provides improved nucleic acid ligands with enhanced stability that inhibit coagulation and improved modulators of the nucleic acids to provide ideal modulators of coagulation. These...
|
|
|
7527966 |
Gene regulation in transgenic animals using a transposon-based vector
Administration of modified transposon-based vectors has been used to achieve stable incorporation of exogenous genes into animals. These transgenic animals produce transgenic progeny. Further,...
|
|
|
7527925 |
Purified pol DNA, a recombinant DNA construct for expression of HIV pol polypeptide sequences and a cell containing such construct
Polynucleotide sequences are provided for the diagnosis of the presence of retroviral infection in a human host associated with lymphadenopathy syndrome and/or acquired immune deficiency syndrome,...
|
|
|
7528230 |
Enhanced inserted yellow fluorescence protein and its application
Disclosed are mutated genes for green fluorescence proteins and enhanced inserted YFPs expressed therefrom. The mutant proteins not only maintain their fluorescence even at 37° C., but also...
|
|
|
7527954 |
Method for in vitro evolution of polypeptides
The invention relates to a method for the production and allocation of nucleic acids and polypeptides coded thereby. The method can be used for evolutionary selection of polypeptides in vitro. The...
|
|
|
7528241 |
Methods and reagents for molecular cloning
The present invention provides compositions, methods, and kits for covalently linking nucleic acid molecules. The methods include a strand invasion step, and the compositions and kits are useful...
|
|
|
7528116 |
Kinase suppressor of Ras inactivation for therapy of Ras mediated tumorigenesis
The present invention relates to methods and compositions for the specific inhibition of kinase suppressor of Ras (KSR). In particular, the invention provides genetic approaches and nucleic acids...
|
|
|
7528242 |
Methods and compositions comprising Renilla GFP
The invention relates to methods and compositions utilizing Renilla green fluorescent proteins (rGFP), and Ptilosarcus green fluorescent proteins (pGFP). In particular, the invention relates to...
|
|
|
7528243 |
Nucleotide and amino acid sequences, and assays and methods of use thereof for diagnosis of breast cancer
Novel markers for breast cancer that are both sensitive and accurate. These markers are overexpressed in breast cancer specifically, as opposed to normal breast tissue. The measurement of these...
|