Match Document Document Title
7538202 Enzyme-free isothermal exponential amplification of nucleic acids and nucleic acid analog signals  
An enzyme-free, isothermal method of generating an amplification signal indicative of a target nucleic acid molecule is provided, as are compositions for performing such a method. An advantage of...
7538210 Sucrose-inducible promoter from sweetpotato  
Disclosed herein are a novel sucrose-inducible promoter sequence and a 5′ untranslated region which are derived from sweetpotato ADP-glucose pyrophosphorlyase gene (ibAGP1) (SEQ ID NO: 1). Also...
7537893 Mitochondrial ND5 gene mutations in Parkinson's disease  
The present invention provides methods for diagnosing and treating Parkinson's disease based on mitochondrial mutations. The present invention also provides methods for diagnosing and treating...
7538206 Comparative mycobacterial geneomics as a tool for identifying targets for the diagnosis, prophylaxis or treatment of mycobacterioses  
The present invention is directed to a method of selection of purified nucleotidic sequences or polynucleotides encoding proteins or part of proteins carrying at least an essential function for the...
7537892 Method and sequences for determinate nucleic acid hybridization  
Provided are methods for using nucleic acid sequences having two or more degenerately pairing nucleotides, each degenerate nucleotide having a partially overlapping set of complementarity, to...
7538201 Recombinant herpesvirus and uses thereof  
A recombinant herpesvirus (excluding infectious laryngotracheitis virus) having a DNA that encodes a polypeptide comprising 429 amino acids at the amino terminal end of a protein encoded by the gB...
7537895 Comparative genomic hybridization  
Disclosed are new methods comprising the use of in situ hybridization to detect abnormal nucleic acid sequence copy numbers in one or more genomes wherein repetitive sequences that bind to multiple...
7537929 Genes for male accessory gland proteins in Drosophila melanogaster  
The present invention provides a number of accessory gland proteins from Drosophila . The invention also provides an accessory gland protein which is toxic to insect cells and can be used to kill...
7538208 Type III secretion pathway in Aeromonas salmonicida, and uses therefor  
Disclosed is a newly identified and characterized type III secretion system in Aeromonas salmonicida . The invention also encompasses the use of components of the novel secretion system in...
7538207 Polyepitope carrier protein  
The invention relates to polyepitope carrier proteins that comprise at least five CD4+T cell epitopes, for conjugation to capsular polysaccharides. The carrier proteins are use useful as components...
7538200 Thermal tolerant avicelase from Acidothermus cellulolyticus  
The invention provides a thermal tolerant (thermostable) cellulase, AviIII, that is a member of the glycoside hydrolase (GH) family. AviIII was isolated and characterized from Acidothermus...
7534445 Chlamydia protein, sequence and uses thereof  
A high molecular weight (“HMW”) protein of chlamydia , the amino acid sequence thereof, and antibodies that specifically bind the HMW protein are disclosed as well as the nucleic acid sequence...
7534878 Composition and methods of RNAi therapeutics for treatment of cancer and other neovascularization diseases  
Compositions and methods are provided for treatment of diseases involving unwanted neovascularization (NV). The invention provides treatments that control NV through selective inhibition of...
7534621 Method of producing probe medium and method of immobilizing probe using probe medium  
When a probe medium is spotted on a substrate, a probe can be effectively and stably immobilized on the substrate. The probe medium includes a probe capable of specifically binding to a target...
7534564 Methods and compositions for polypeptide engineering  
Methods are provided for the evolution of proteins of industrial and pharmaceutical interest, including methods for effecting recombination and selection. Compositions produced by these methods are...
7534560 Simple catalytic DNA biosensors for ions based on color changes  
Disclosed are compositions and methods for the sensitive and selective detection of ions using nucleic acid enzymes and DNA modified microparticles.
7534931 Method for producing modified starch  
A method for modifying plants by manipulating the activity of a combination of plant enzymes having starch synthase activity, in particular starch synthase II (SSII) and starch synthase III...
7534875 Compositions for glioma classification  
The present invention provides novel compositions and their use in classifying gliomas. In a preferred embodiment, the methods are used to discriminate between oligodendroglioma and glioblastoma.
7534873 Method and materials for quaternary amine catalyzed bisulfite conversion of cytosine to uracil  
The invention provides methods and materials for the conversion of cytosine to uracil. A nucleic acid, such a gDNA, is reacted with bisulfate, such as magnesium bisulfite, in the presence of a...
7534775 Methods and compositions for modulating cardiac contractility  
Methods and compositions are provided for modulating cardiac contractility by regulating transcription of the phsopholamban gene using engineered zinc finger proteins.
7534872 Compositions and methods for the use of FMOC derivatives in DNA/RNA synthesis  
Methods of nucleic acid preparation are described, including preparation of mRNA, using FMOC derivatives to synthesize oligonucleotides in addition to applying FMOC protocols to various therapeutic...
7534932 Root-specific phosphate transporter promoters  
The current invention provides plant promoter sequences. Compositions comprising the promoter sequence are described, as are methods for the expression of transgenes in plants comprising the use of...
7534561 Nucleic acid array in situ fabrication methods and arrays produced using the same  
Methods and devices for producing a nucleic acid arrays using in situ nucleic acid array synthesis protocols are provided. A feature of certain embodiments of the invention is that control probes...
7534568 Methods for detection of a target nucleic acid by forming a cleavage structure with a cleavage resistant probe  
The invention relates to compositions and methods for generating a signal indicative of the presence of a target nucleic acid in a sample utilizing a cleavage resistant probe.
7534874 Gene involved in V(D)J recombination and/or DNA repair  
The invention related to a new gene and protein involved in V(D)J recombination and/or DNA repair. The invention also relates to methods of diagnosis and therapy using these gene and protein. The...
7534449 Targeted and high density drug loaded polymeric materials  
Polymeric delivery devices have been developed which combine high loading/high density of molecules to be delivered with the option of targeting. As used herein, “high density” refers to...
7534569 Method of generating long nucleic acid molecules of defined sequence  
A method of generating a single-stranded nucleic acid molecule comprising (a) combining in a mixture under conditions suitable for a polymerase extension reaction, (i) a polymerase, (ii) an initial...
7534565 DLC-1 gene deleted in cancers  
A cDNA molecule corresponding to a newly discovered human gene is disclosed. The new gene, which is frequently deleted in liver cancer cells and cell lines, is called the DLC-1 gene. Because the...
7534566 Nucleic acid labeling method and liquid composition  
It is provided a nucleic acid labeling method that can reduce to a minimum the amount of a labeling substance used and can effectively incorporate the labeling substance into a product, a target...
7534587 Microsatellite markers for plants of the genus Triticeae and use thereof  
The invention relates to novel microsatellite markers for wheats ( Triticum aestivum ) and closely related species (Genus Triticeae ) and to the use of said markers for the genetic analysis of...
7531717 Regulatory genes involved in condensed tannin synthesis in plants  
The present invention provides two novel regulatory genes and encoded proteins which can be used to alter the biosynthesis and accumulation of condensed tannin levels in plants and plant tissues....
7531626 Tenebrio antifreeze proteins  
A novel class of thermal hysteresis (antifreeze) proteins (THP) that have up to 100 times the specific activity of fish antifreeze proteins has been isolated and purified from the mealworm beetle, ...
7531647 Lentiviral vectors for site-specific gene insertion  
Murine leukemia virus (MLV) and lentivirus vectors have been used previously to deliver genes to hematopoietic stem cells (HSCs) in human gene therapy trials. However, these vectors integrate...
7531714 Melusin a muscle specific protein, as a drug target for prevention and treatment of heart failure  
The present invention concerns non-human transgenic animals as model study for human pathologies, being transgenic for having altered melusin expression. The non-human transgenic animals are to be...
7531332 Method for producing a lower alkyl ester of α-L-aspartyl-L-phenylalanine using Escherichia bacteria  
A method for producing an L-amino acid, such as L-phenylalanine and L-threonine, is provided using an Escherichia bacterium, wherein the L-amino acid productivity of said bacterium is enhanced by...
7531317 Fluorescence polarization assay to detect protease cleavage  
The invention discloses a method of determining protease activity, in real time, using fluorescence polarization technology. In particular, the invention provides vectors and a method for their...
7531305 Human Papilloma Virus detection with DNA microarray  
A method is provided of detecting the presence of HPV comprising the following steps: a. amplification and labelling part of the E1 HPV gene, in particular its 3′ end; b. hydrizing the labelled...
7531726 Controlled alignment of nanobarcodes encoding specific information for scanning probe microscopy (SPM) reading  
The methods, apparatus and compositions disclosed herein concern the detection, identification and/or sequencing of biomolecules, such as nucleic acids or proteins. In certain embodiments of the...
7531509 Papillosin antimicrobial peptide, a gene coding said peptide, a vector, a transformed organism and a compound containing said organism  
An antimicrobial peptide isolated from an extract from a marine invertebrate, whose amino acid sequence is as follows: GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ (SEQ ID No. 1), its derivatives, its...
7531326 Chimeric retinoid X receptors and their use in a novel ecdysone receptor-based inducible gene expression system  
This invention relates to the field of biotechnology or genetic engineering. Specifically, this invention relates to the field of gene expression. More specifically, this invention relates to a...
7531649 Aptamers to human epidermal growth factor receptor-3  
The disclosure provided herein provides compositions of nucleic acid aptamers that bind human epidermal growth factor receptor-3 and methods for their use.
7531524 Modulators of coagulation factors with enhanced stability  
The invention provides improved nucleic acid ligands with enhanced stability that inhibit coagulation and improved modulators of the nucleic acids to provide ideal modulators of coagulation. These...
7527966 Gene regulation in transgenic animals using a transposon-based vector  
Administration of modified transposon-based vectors has been used to achieve stable incorporation of exogenous genes into animals. These transgenic animals produce transgenic progeny. Further,...
7527925 Purified pol DNA, a recombinant DNA construct for expression of HIV pol polypeptide sequences and a cell containing such construct  
Polynucleotide sequences are provided for the diagnosis of the presence of retroviral infection in a human host associated with lymphadenopathy syndrome and/or acquired immune deficiency syndrome,...
7528230 Enhanced inserted yellow fluorescence protein and its application  
Disclosed are mutated genes for green fluorescence proteins and enhanced inserted YFPs expressed therefrom. The mutant proteins not only maintain their fluorescence even at 37° C., but also...
7527954 Method for in vitro evolution of polypeptides  
The invention relates to a method for the production and allocation of nucleic acids and polypeptides coded thereby. The method can be used for evolutionary selection of polypeptides in vitro. The...
7528241 Methods and reagents for molecular cloning  
The present invention provides compositions, methods, and kits for covalently linking nucleic acid molecules. The methods include a strand invasion step, and the compositions and kits are useful...
7528116 Kinase suppressor of Ras inactivation for therapy of Ras mediated tumorigenesis  
The present invention relates to methods and compositions for the specific inhibition of kinase suppressor of Ras (KSR). In particular, the invention provides genetic approaches and nucleic acids...
7528242 Methods and compositions comprising Renilla GFP  
The invention relates to methods and compositions utilizing Renilla green fluorescent proteins (rGFP), and Ptilosarcus green fluorescent proteins (pGFP). In particular, the invention relates to...
7528243 Nucleotide and amino acid sequences, and assays and methods of use thereof for diagnosis of breast cancer  
Novel markers for breast cancer that are both sensitive and accurate. These markers are overexpressed in breast cancer specifically, as opposed to normal breast tissue. The measurement of these...