Matches 1 - 50 out of 231 1 2 3 4 5 >
Match Document Document Title
7390489 Monoclonal antibody selectively recognizing listeria monocytogenes, hybridoma producing the antibody, test kit comprising the antibody and detection method of listeria monocytogenes using the antibody  
The present invention relates to a monoclonal antibody binding specifically to the p60 protein of Listeria monocytogenes , a hybridoma cell producing the monoclonal antibody, a test kit comprising...
7364738 Monoclonal antibodies to the CLFA protein and method of use in treating infections  
Monoclonal antibodies which can bind to the ClfA protein and which are generated from binding subdomains or active fragments of the ClfA protein from Staphylococcus aureus , including the active...
7355016 Methods for detection of mycobacteria  
Nucleic acid encoding four novel immunodeterminant protein antigens of M. bovis BCG, which is a vaccine strain for tuberculosis, have been isolated. These genes were isolated as immunoreactive...
7329738 Assays for detection of Bacillus anthracis  
This invention provides novel methods, reagents, and kits that are useful for detecting B. anthracis . The methods are based on the discovery of binding agents, including recombinant polyclonal...
7303891 Method of detecting Lawsonia intracellularis antibodies  
The present invention relates to the field of animal health and in particular to Lawsonia intracellularis . In particular, the invention relates to a method of diagnosing Lawsonia intracellularis...
7291334 Antibodies to novel proteins in enteroaggregative Escherichia coli (EAEC) useful for diagnosis and therapy of EAEC infections  
Novel proteins and their corresponding nucleotide sequences in enteroaggregative Escherichia coli (EAEC) are provided. In particular, Aap and the five gene cluster (aat) of the AA probe region of...
7271251 Helicobacter pylori adhesin binding group antigen  
A novel Helicobacter pylori blood group antigen binding (BAB) adhesin protein was isolated and purified, whereby said protein or fractions thereof bind specifically to fucosylated blood group...
7250494 Opsonic monoclonal and chimeric antibodies specific for lipoteichoic acid of Gram positive bacteria  
The present invention encompasses monoclonal antibodies that bind to lipoteichoic acid (LTA) of Gram positive bacteria. The antibodies also bind to whole bacteria and enhance phagocytosis and...
7241592 Cross-reactive displacing antibodies from collagen-binding proteins and method of identification and use  
Antibodies to the CNA protein and to other regions from the collagen binding domain, including domain CNA19, are provided, and antibodies produced in this manner have been shown to be cross...
7230087 P. aeruginosa mucoid exopolysaccharide specific binding peptides  
The present invention relates to peptides, particularly human monoclonal antibodies, that bind specifically to P. aeruginosa mucoid exopolysaccharide. The invention further provides methods for...
7217795 Tumor suppressor designated TS10q23.3  
A specific region of chromosome 10 (10q23.3) has been implicated by series of studies to contain a tumor suppressor gene involved in gliomas, as well as a number of other human cancers. One gene...
7160990 Antibodies to a fibrinogen binding protein of staphylococcus epidermidis  
A new fibrinogen binding protein or polypeptide originating from coagulase negative staphylococci, biotechnological methods for producing the protein or polypeptide having fibrinogen binding...
7151159 Amino acid sequences for therapeutic and prophylactic use against diseases due to clostridium difficile toxins  
The invention relates to monoclonal antibodies capable of recognizing and neutralizing epitopes from the ligand domain, the translocation domain or the catalytic domain of the enterotoxin (toxin A)...
7094883 Monoclonal antibody which agglutinates E. coli having the CS4-CFA/I family protein  
A monoclonal antibody to a consensus peptide of the formula: VEKKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID NO. 1) is described. The monoclonal antibody of the invention binds...
7087228 Preventing tooth decay and infective endocarditis using natural oligopeptides  
The present invention provides compositions, medicaments, and methods for the treatment or prophylaxis of conditions associated with the binding of Streptococcus mutans to teeth. Specifically,...
7078492 Human antipneumococcal antibodies from non-human animals  
The invention described herein provides human antibodies produced in non-human animals that specifically bind to Streptococcus pneumoniae capsular polysaccharide (PPS-3). The invention further...
7067128 Polyspecific immunoconjugates and antibody composites for targeting the multidrug resistant phenotype  
Polyspecific immunoconjugates and antibody composites that bind a multidrug transporter protein and an antigen associated with a tumor or infectious agent are used to overcome the multidrug...
7060799 Antibody for ligand capture assay  
The present invention provides a novel method for the identification and clonal isolation of antibodies that bind to unique epitopes. The method is based on the use of antibodies as solid phase...
7049085 Antibodies against type a botulinum neurotoxin  
Antibodies for binding epitopes of BoNT/A and hybridomas which produce such antibodies are described. The antibodies of the present invention can be used in a method for detecting BoNT/A in a...
7025961 Anti-plasmodium composition and methods of use  
Compositions that inhibit the binding of Plasmodium falciparum to erythrocytes are provided. More particularly, antibodies specific for Plasmodium falciparum binding proteins and blocking...
7011836 Mutants of gram negative mucosal bacteria and application thereof in vaccines  
It is possible to inactivate the early stage of lipid A synthesis of mucosal gram negative bacteria without compromising cell viability. In particular the lpxA gene in N. meningitidis was mutated...
6994854 Protective epitopes of adenyl cyclase-haemolysin (AC-Hly), their application to the treatment or to the prevention of bordetella infections  
The subject of the invention is amino acid sequences of the AC-Hly from B. pertussis, B. parapertussis and/or B. bronchiseptica , carrying epitopes capable of inducing a protective immune...
6967240 Congener independent detection of microcystin and nodularin congeners  
The present invention relates to a protienaceous compound or functionally active derivative or part thereof having a binding site for a group represented by formula (I) which is part of a group of...
6951925 Processes and agents for detecting Listerias  
The invention relates to agents and processes for detecting bacteria of the genus Listeria, in particular L. monocytogenes. The agents according to the invention include primers whose sequence...
6942861 Histidine-tagged intimin and methods of using intimin to stimulate an immune response and as an antigen carrier with targeting capability  
The present invention describes the isolation and purification of histidine-tagged functional portions of intimin (his-tagged intimin or his-intimin), a protein associated with the ability of...
6939543 Opsonic and protective monoclonal and chimeric antibodies specific for lipoteichoic acid of gram positive bacteria  
The present invention encompasses monoclonal and chimeric antibodies that bind to lipoteichoic acid of Gram positive bacteria. The antibodies also bind to whole bacteria and enhance phagocytosis...
6936259 CAMP factor of Streptococcus uberis  
The CAMP factor gene of Streptococcus uberis ( S. uberis ) is described, as well as the recombinant production of CAMP factor therefrom. Also disclosed are chimeric CAMP factor constructs,...
6923963 Diagnosis of ehrlichia canis and ehrlichia chaffeensis  
Diagnostic tools for for serodiagnosing ehrlichiosis in mammals, particularly in members of the Canidae family and in humans are provided. The diagnostic tools are a group of outer membrane...
6921809 Monoclonal antibody to the stabilizer peptide of the P64K antigen of Neisseria meningitidis  
The present invention related to biotechnology and genetic engineering, particularly the expression of proteins of viral origin in microorganisms through their fusion by applying recombinant DNA...
6913756 Monoclonal antibodies specific for anthrax and peptides derived from the antibodies thereof  
The present invention provides monoclonal antibodies which are highly specific for Bacillus spores. Also provided are peptides derived from those monoclonal antibodies. Both the antibodies and...
6908619 Camp factor of streptococcus uberis  
The CAMP factor gene of Streptococcus uberis ( S. uberis ) is described, as well as the recombinant production of CAMP factor therefrom. CAMP factors can be used in vaccine compositions for the...
6881410 Treatment of E. faecium infection  
The present invention provides bacterial and fungal ABC transporter proteins, immunogenic fragments thereof, neutralising agents specific thereto and binding agents specific thereto for therapeutic...
6872543 Method for assessing the risk of peptic ulcer, comprising the steps of determining quantitatively the concentrations of pepsinogen I (PGI) and gastrin-17 in a serum sample  
The present invention concerns a method for assessing the risk of peptic ulcer by determining the presence and topographic phenotype of gastritis in an individual, by determining quantitatively the...
6841154 Cross-reactive monoclonal and polyclonal antibodies which recognize surface proteins from coagulase-negative staphylococci and Staphylococcus aureus  
Polyclonal and monoclonal antibodies which are cross-reactive to both coagulase-positive staphylococcus bacteria, such as S. aureus and to coagulase-negative bacteria, such as S. epidermidis ...
6825325 Molecular pathogenicide mediated plant disease resistance  
The present invention is drawn to a fusion protein containing at least one binding domain that specifically recognizes an eptitope of a plant pathogen and at least one additional domain made from a...
6822075 Protein L and hybrid proteins thereof  
The invention relates to sequences of protein L which bind to light chains of immunoglobulins. The invention also relates to hybrid proteins thereof which are able to bind to both light and heavy...
6713059 Antibodies raised against immunogenic conjugates of gram-negative bacterial autoinducer molecules  
The present invention relates to an immunogenic conjugate comprising a carrier molecule coupled to an autoinducer of a Gram negative bacteria. The immunogenic conjugate, when combined with a...
6692739 Staphylococcal immunotherapeutics via donor selection and donor stimulation  
A method and composition for the passive immunization of patients infected with or susceptible to infection from Staphylococcus bacteria such as S. aureus and S. epidermidis infection is...
6686453 Antifucoidan antibody  
An antifucoidan antibody recognizing the compound represented by formula (I) or (II).
6686169 Reagent for the detection of Staphylococcus aureus by agglutination  
Reagents and methods for the detection of Staphylococcus aureus are provided. The reagents contain an antibody that binds to a capsular polysaccharide of type 5 of Staphylococcus aureus , and...
6680374 Invaplex from gram negative bacteria, method of purification and methods of use  
Isolated antibodies to Invaplex; novel compositions comprising immunoglobulins directed to invasin proteins and LPS from gram negative bacteria that selectively bind to Invaplex, and do not bind to...
6670462 Protein fragments for use in protein targeting  
A protein is described. The protein comprises a lipid globule targeting sequence linked to a protein of interest (POI) wherein the targeting sequence comprises a hepatitis C virus (HCV) core...
6667158 Antibodies against type a botulinum neurotoxin  
Antibodies for binding epitopes of BoNT/A and hybridomas which produce such antibodies are described. The antibodies of the present invention can be used in a method for detecting BoNT/A in a...
6667035 Amino acid sequences for therapeutic and prophylactic use against diseases due to Clostridium difficile toxins  
The invention relates to monoclonal antibodies capable of recognizing and neutralizing epitopes from the ligand domain, the translocation domain or the catalytic domain of the enterotoxin (toxin A)...
6663862 Reagents for detection and purification of antibody fragments  
An isolated B1 domain polypeptide of bacterial Protein G which binds a Fab fragment of an IgG but substantially does not bind a Fc fragment of an IgG. Methods for the detection and purification of...
6649744 Rnase P polypeptides, polynucleotides, and methods using their mechanisms of action  
This invention relates to a novel bacterial ribonucleoprotein complex and the component parts thereof. More specifically, this invention relates to RNase P RNA isolated from Staphylococcus aureus ...
6551599 Monoclonal antibodies against campylobacter jejuni and campylobacter coli outer membrane antigens  
The present invention is directed to a method of producing monoclonal antibodies that are highly specific for (1) unique epitopes of Campylobacter jejuni (Cj) only and (2) epitopes conserved...
6545130 Monoclonal antibodies to mycobacterium tuberculosis and a modified ELISA assay  
The present invention provides for monoclonal antibodies, the hybridoma cell lines which produce these antibodies, and the use of such monoclonal antibodies in the detection of M. tuberculosis. ...
6544516 Treatment and diagnosis of infections of gram positive cocci  
The present invention provides bacterial and fungal ABC transporter proteins, immunogenic fragments thereof, neutralizing agents specific thereto and binding agents specific thereto for therapeutic...
6537550 Use of avian antibodies  
The present invention relates to use of avian antibodies and/or antigen binding fragments thereof, for the production of a drug for treatment and/or prevention of respiratory tract infection. The...
Matches 1 - 50 out of 231 1 2 3 4 5 >