Match Document Document Title
7125551 Methods for treatment of asthmatic disorders using a monoclonal antibody to 8F4 polypeptide  
The present invention relates to methods and compositions for the prevention and treatment and prevention of immune system disorders, including cancer, AIDS, asthmatic disorders, autoimmune...
7125678 Protein biopolymer markers predictive of type II diabetes  
The instant invention involves the use of a combination of preparatory steps in conjunction with mass spectroscopy and time-of-flight detection procedures to maximize the diversity of biopolymers...
7125962 Anti-Pro268 antibodies  
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
7122327 Biopolymer markers indicative of type II diabetes  
The instant invention involves the use of a combination of preparatory steps in conjunction with mass spectroscopy and time-of-flight detection procedures to maximize the diversity of biopolymers...
7122639 Chemokine alpha-2 antibodies  
Human chemokine Alpha-2-polypeptides and DNA (RNA) encoding such chemotactic cytokines and a procedure for producing such polypeptides by recombinant techniques is disclosed. Also disclosed are...
7122324 Vitro methods for determining in vivo thrombotic events  
Diagnostic systems, methods, polypeptides and antibodies for detecting the presence of C-terminal hGPIIb fragment of the platelet receptor GPIIb-IIIa in a body fluid sample are disclosed.
7118912 Methods and compositions for categorizing patients  
The disclosure provides, among other things, molecular markers for categorizing the neoplastic state of a patient, methods for using the molecular markers in diagnostic tests, nucleic acid and...
7119175 Antibody to mammalian cytokine-like polypeptide-10  
A mammalian cytokine-like polypeptide, called Zcyto10, polynucleotides encoding the same, antibodies which specifically bind to the polypeptide, and anti-idiotypic antibodies which bind to the...
7119174 Diagnosis and treatment of AUR1 and/or AUR2 related disorders  
The present invention relates to AUR1 and/or AUR2 polypeptides, nucleic acids encoding such polypeptides, cells, tissues and animals containing such nucleic acids, antibodies to such polypeptides,...
7119173 Secreted and transmembrane polypeptides and nucleic acids encoding the same  
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
7119176 Antibodies specific to human prostacyclin synthase  
The present invention clarifies the primary structure of human-originated PGIS and the nucleotide sequence encoding same. The PGIS and its DNA are useful as reagents for the development of...
7115379 Anti-mammalian CX3C cytokine antibodies  
Nucleic acids encoding a new family of chemokines, the CX3C family, from a mammal, reagents related thereto, including specific antibodies, and purified proteins are described. Methods of using...
7112325 Antibodies to calcium independent cytosolic phospholipase A2/B enzymes  
The invention provides a novel calcium-independent cytosolic phospholipase A 2 /B enzyme, polynucleotides encoding such enzyme, antibodies to such enzyme, and methods for screening unknown...
7112662 Anti-metasin antibodies and their methods of use  
The present invention aims at providing an antibody, by which metastin or its derivative can be quantified specifically with a high sensitivity, a method of detecting/quantifying metastin or its...
7108992 ATM kinase compositions and methods  
The present invention provides methods for detecting activation of ATM kinase, DNA damage, and DNA damaging agents. Further provided are antibodies which specifically recognize the phosphorylation...
7109309 Peptide fructose and protein conjugate with the same  
It is intended to provide an antibody specific to HbA1c, antibody-producing cells capable of supplying the antibody in a stable state in the future, and a method of constructing the...
7109305 Secreted and transmembrane polypeptides and nucleic acids encoding the same  
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
7108986 Glypican-1 in human breast cancer  
Glycosylphosphatidylinositol-(GPI-) anchored HSPG glypican-1 is strongly expressed in human breast and pancreatic cancer—both by the cancer cells and in the case of pancreatic cancer the adjacent...
7109306 Antibodies to human oncogene induced secreted protein I  
The present invention relates to a novel protein, the Human Oncogene Induced Secreted Protein I (“HOIPS I”) protein. In particular, isolated nucleic acid molecules are provided encoding the...
7105641 MCP-1 receptor antibodies  
Novel human chemokine receptors, MCP-1RA and MCP-1RB, and processes for producing them are disclosed. The receptors, which are alternately spliced versions of MCP-1 receptor protein may be used in...
7105149 Isolation of five novel genes coding for new Fc receptors-type melanoma involved in the pathogenesis of lymphoma/myeloma  
This invention provides an isolated nucleic acid molecule which encodes immunoglobulin receptor, Immunoglobulin superfamily Receptor Translocation Associated, IRTA, protein. Provided too, are the...
7105159 Antibodies to prostate-specific membrane antigen  
This invention provides purified antibodies to the outer membrane domain of prostate-specific membrane (PSM) antigen, compositions of matter comprising PSM antigen antibodies conjugated to a...
7105640 Anti-pro792 antibodies  
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
7105639 Anti-PRO 4405 antibodies  
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
7105644 Secreted protein HHTLF25 antibodies  
The present invention relates to novel human secreted proteins and isolated nucleic acids containing the coding regions genes encoding such proteins. Also provided are vectors, host cells,...
7101554 Picornaviruses, vaccines and diagnostic kits  
A new group of picornaviruses is disclosed. The picornaviruses of the invention comprise in the non-coding region of their viral genome a nucleotide sequence which corresponds to cDNA sequence (I)...
7101962 Antibodies of the P2Y10 receptor useful in altering T lymphocyte function  
The present invention relates to modulators of P2Y10. Various modulators are disclosed, including an antibody that binds specifically to P2Y10. The present invention also relates to methods of...
7101978 TNF-α binding molecules  
The present invention relates to TNF-α binding molecules and nucleic acid sequences encoding TNF-α binding molecules. In particular, the present invention relates to TNF-α binding molecules with...
7101979 Antibodies to antiangiogenic compositions and methods  
Antibody to endostatin protein that is an inhibitor of endothelial cell proliferation, capable of inhibiting angiogenesis and causing tumor regression, that is approximately 18 kDa as determined by...
7098316 Human proteins  
The present invention relates to novel human proteins and isolated nucleic acids containing the coding regions of the genes encoding such proteins. Also provided are vectors, host cells and...
7097989 Complement C3 precursor biopolymer markers predictive of type II diabetes  
The instant invention involves the use of a combination of preparatory steps in conjunction with mass spectroscopy and time-of-flight detection procedures to maximize the diversity of biopolymers...
7097985 Antibodies to human chemokine beta-9  
Human Ckβ-9 polypeptides and DNA (RNA) encoding such chemokine polypeptides and a procedure for producing such polypeptides by recombinant techniques is disclosed. Also disclosed are methods for...
7094883 Monoclonal antibody which agglutinates E. coli having the CS4-CFA/I family protein  
A monoclonal antibody to a consensus peptide of the formula: VEKKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID NO. 1) is described. The monoclonal antibody of the invention binds...
7094882 Growth factor which acts through erb b-4 rtk  
A novel ErbB-4 ligand, referred to herein as Neuregulin-4 (NRG-4) is disclosed as well as polynucleotide sequences encoding NRG-4, oligonucleotides and oligonucleotide analogs derived from...
7094549 Fibronectin biopolymer marker indicative of insulin resistance  
The instant invention involves the use of a combination of preparatory steps in conjunction with mass spectroscopy and time- of-flight detection procedures to maximize the diversity of biopolymers...
7091322 Human endometrial specific steroid-binding factor I, II, and III  
The invention relates to hESF I, II and III polypeptides, polynucleotides encoding the polypeptides, methods for producing the polypeptides, in particular by expressing the polynucleotides, and...
7087725 Antibodies specifically reactive with a tumor necrosis factor related ligand  
The present invention relates to Tumor Necrosis Factor Related Ligand (TRELL), a novel member of the tumor necrosis factor family (TNF), modified TRELL, and pharmaceutical compositions comprising...
7087391 Antibody to hepatocyte growth factor activator inhibitor-1 and use thereof  
A hybridoma is selected that produces a monoclonal antibody exhibiting high reactivity to soluble hepatocyte growth factor activator inhibitor-1 (soluble HAI-1), the target monoclonal antibody is...
7087417 tRNA synthetases, metRS  
The invention relates to metRS polypeptides and polynucleotides and methods for producing such polypeptides by recombinant techniques. Also disclosed are methods for utilizing metRS polypeptides...
7083784 Molecules with extended half-lives, compositions and uses thereof  
The present invention provides molecules, including IgGs, non-IgG immunoglobulin, proteins and non-protein agents, that have increased in vivo half-lives due to the presence of an IgG constant...
7084258 Antibodies against the PRO862 polypeptides  
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
7084257 Fully human antibody Fab fragments with human interferon-gamma neutralizing activity  
Selective binding agents of interferon-gamma (IFNγ) are provided by the invention. More particularly, the invention provides for antibodies and antigen binding domains which selectively bind to...
7081519 Antibodies to serine protease polypeptides  
Antibodies that specifically bind to novel serine protease polypeptides are disclosed. The polypeptides are selected from the group consisting of a polypeptide as shown in SEQ ID NO:2 from residue...
7081521 Anti-PRO788 antibodies  
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
7081520 Anti-pro 1570 antibodies  
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
7070774 Antibodies that bind testis-specific insulin homolog polypeptides  
The present invention provides testis-specific insulin homolog polypeptides and polynucleotides encoding the polypeptides, as well as related compositions and methods are disclosed. The...
7067636 Anti-pro 1017 antibodies  
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
7067637 Antibody or antibody fragments specific for a protein of the TGF-β family  
The invention provides antibody and antibody fragments which specifically bind to novel members of the TGF-β family of proteins. The TFG-β family comprises proteins which function as growth...
7067314 Monoclonal antibody, its immunoreactive fragment and hybridoma  
It is an object to utilize a novel HSCA-3 antigen occurring in immature hemopoietic stem cells and a monoclonal antibody recognizing said antigen in 1) the immunoassay or flow cytometry involving...
7067635 Nucleotide and deduced amino acid sequences of tumor gene Int6  
The present invention discloses the isolation of the human and murine wild-type Int6 gene and the cDNAs sorresponding to these genes. The invention further describes the use of reagents derived...