|
Match
|
Document |
Document Title |
|
|
7125551 |
Methods for treatment of asthmatic disorders using a monoclonal antibody to 8F4 polypeptide
The present invention relates to methods and compositions for the prevention and treatment and prevention of immune system disorders, including cancer, AIDS, asthmatic disorders, autoimmune...
|
|
|
7125678 |
Protein biopolymer markers predictive of type II diabetes
The instant invention involves the use of a combination of preparatory steps in conjunction with mass spectroscopy and time-of-flight detection procedures to maximize the diversity of biopolymers...
|
|
|
7125962 |
Anti-Pro268 antibodies
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
|
|
|
7122327 |
Biopolymer markers indicative of type II diabetes
The instant invention involves the use of a combination of preparatory steps in conjunction with mass spectroscopy and time-of-flight detection procedures to maximize the diversity of biopolymers...
|
|
|
7122639 |
Chemokine alpha-2 antibodies
Human chemokine Alpha-2-polypeptides and DNA (RNA) encoding such chemotactic cytokines and a procedure for producing such polypeptides by recombinant techniques is disclosed. Also disclosed are...
|
|
|
7122324 |
Vitro methods for determining in vivo thrombotic events
Diagnostic systems, methods, polypeptides and antibodies for detecting the presence of C-terminal hGPIIb fragment of the platelet receptor GPIIb-IIIa in a body fluid sample are disclosed.
|
|
|
7118912 |
Methods and compositions for categorizing patients
The disclosure provides, among other things, molecular markers for categorizing the neoplastic state of a patient, methods for using the molecular markers in diagnostic tests, nucleic acid and...
|
|
|
7119175 |
Antibody to mammalian cytokine-like polypeptide-10
A mammalian cytokine-like polypeptide, called Zcyto10, polynucleotides encoding the same, antibodies which specifically bind to the polypeptide, and anti-idiotypic antibodies which bind to the...
|
|
|
7119174 |
Diagnosis and treatment of AUR1 and/or AUR2 related disorders
The present invention relates to AUR1 and/or AUR2 polypeptides, nucleic acids encoding such polypeptides, cells, tissues and animals containing such nucleic acids, antibodies to such polypeptides,...
|
|
|
7119173 |
Secreted and transmembrane polypeptides and nucleic acids encoding the same
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
|
|
|
7119176 |
Antibodies specific to human prostacyclin synthase
The present invention clarifies the primary structure of human-originated PGIS and the nucleotide sequence encoding same. The PGIS and its DNA are useful as reagents for the development of...
|
|
|
7115379 |
Anti-mammalian CX3C cytokine antibodies
Nucleic acids encoding a new family of chemokines, the CX3C family, from a mammal, reagents related thereto, including specific antibodies, and purified proteins are described. Methods of using...
|
|
|
7112325 |
Antibodies to calcium independent cytosolic phospholipase A2/B enzymes
The invention provides a novel calcium-independent cytosolic phospholipase A 2 /B enzyme, polynucleotides encoding such enzyme, antibodies to such enzyme, and methods for screening unknown...
|
|
|
7112662 |
Anti-metasin antibodies and their methods of use
The present invention aims at providing an antibody, by which metastin or its derivative can be quantified specifically with a high sensitivity, a method of detecting/quantifying metastin or its...
|
|
|
7108992 |
ATM kinase compositions and methods
The present invention provides methods for detecting activation of ATM kinase, DNA damage, and DNA damaging agents. Further provided are antibodies which specifically recognize the phosphorylation...
|
|
|
7109309 |
Peptide fructose and protein conjugate with the same
It is intended to provide an antibody specific to HbA1c, antibody-producing cells capable of supplying the antibody in a stable state in the future, and a method of constructing the...
|
|
|
7109305 |
Secreted and transmembrane polypeptides and nucleic acids encoding the same
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
|
|
|
7108986 |
Glypican-1 in human breast cancer
Glycosylphosphatidylinositol-(GPI-) anchored HSPG glypican-1 is strongly expressed in human breast and pancreatic cancer—both by the cancer cells and in the case of pancreatic cancer the adjacent...
|
|
|
7109306 |
Antibodies to human oncogene induced secreted protein I
The present invention relates to a novel protein, the Human Oncogene Induced Secreted Protein I (“HOIPS I”) protein. In particular, isolated nucleic acid molecules are provided encoding the...
|
|
|
7105641 |
MCP-1 receptor antibodies
Novel human chemokine receptors, MCP-1RA and MCP-1RB, and processes for producing them are disclosed. The receptors, which are alternately spliced versions of MCP-1 receptor protein may be used in...
|
|
|
7105149 |
Isolation of five novel genes coding for new Fc receptors-type melanoma involved in the pathogenesis of lymphoma/myeloma
This invention provides an isolated nucleic acid molecule which encodes immunoglobulin receptor, Immunoglobulin superfamily Receptor Translocation Associated, IRTA, protein. Provided too, are the...
|
|
|
7105159 |
Antibodies to prostate-specific membrane antigen
This invention provides purified antibodies to the outer membrane domain of prostate-specific membrane (PSM) antigen, compositions of matter comprising PSM antigen antibodies conjugated to a...
|
|
|
7105640 |
Anti-pro792 antibodies
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
|
|
|
7105639 |
Anti-PRO 4405 antibodies
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
|
|
|
7105644 |
Secreted protein HHTLF25 antibodies
The present invention relates to novel human secreted proteins and isolated nucleic acids containing the coding regions genes encoding such proteins. Also provided are vectors, host cells,...
|
|
|
7101554 |
Picornaviruses, vaccines and diagnostic kits
A new group of picornaviruses is disclosed. The picornaviruses of the invention comprise in the non-coding region of their viral genome a nucleotide sequence which corresponds to cDNA sequence (I)...
|
|
|
7101962 |
Antibodies of the P2Y10 receptor useful in altering T lymphocyte function
The present invention relates to modulators of P2Y10. Various modulators are disclosed, including an antibody that binds specifically to P2Y10. The present invention also relates to methods of...
|
|
|
7101978 |
TNF-α binding molecules
The present invention relates to TNF-α binding molecules and nucleic acid sequences encoding TNF-α binding molecules. In particular, the present invention relates to TNF-α binding molecules with...
|
|
|
7101979 |
Antibodies to antiangiogenic compositions and methods
Antibody to endostatin protein that is an inhibitor of endothelial cell proliferation, capable of inhibiting angiogenesis and causing tumor regression, that is approximately 18 kDa as determined by...
|
|
|
7098316 |
Human proteins
The present invention relates to novel human proteins and isolated nucleic acids containing the coding regions of the genes encoding such proteins. Also provided are vectors, host cells and...
|
|
|
7097989 |
Complement C3 precursor biopolymer markers predictive of type II diabetes
The instant invention involves the use of a combination of preparatory steps in conjunction with mass spectroscopy and time-of-flight detection procedures to maximize the diversity of biopolymers...
|
|
|
7097985 |
Antibodies to human chemokine beta-9
Human Ckβ-9 polypeptides and DNA (RNA) encoding such chemokine polypeptides and a procedure for producing such polypeptides by recombinant techniques is disclosed. Also disclosed are methods for...
|
|
|
7094883 |
Monoclonal antibody which agglutinates E. coli having the CS4-CFA/I family protein
A monoclonal antibody to a consensus peptide of the formula:
VEKKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID NO. 1) is described.
The monoclonal antibody of the invention binds...
|
|
|
7094882 |
Growth factor which acts through erb b-4 rtk
A novel ErbB-4 ligand, referred to herein as Neuregulin-4 (NRG-4) is disclosed as well as polynucleotide sequences encoding NRG-4, oligonucleotides and oligonucleotide analogs derived from...
|
|
|
7094549 |
Fibronectin biopolymer marker indicative of insulin resistance
The instant invention involves the use of a combination of preparatory steps in conjunction with mass spectroscopy and time- of-flight detection procedures to maximize the diversity of biopolymers...
|
|
|
7091322 |
Human endometrial specific steroid-binding factor I, II, and III
The invention relates to hESF I, II and III polypeptides, polynucleotides encoding the polypeptides, methods for producing the polypeptides, in particular by expressing the polynucleotides, and...
|
|
|
7087725 |
Antibodies specifically reactive with a tumor necrosis factor related ligand
The present invention relates to Tumor Necrosis Factor Related Ligand (TRELL), a novel member of the tumor necrosis factor family (TNF), modified TRELL, and pharmaceutical compositions comprising...
|
|
|
7087391 |
Antibody to hepatocyte growth factor activator inhibitor-1 and use thereof
A hybridoma is selected that produces a monoclonal antibody exhibiting high reactivity to soluble hepatocyte growth factor activator inhibitor-1 (soluble HAI-1), the target monoclonal antibody is...
|
|
|
7087417 |
tRNA synthetases, metRS
The invention relates to metRS polypeptides and polynucleotides and methods for producing such polypeptides by recombinant techniques. Also disclosed are methods for utilizing metRS polypeptides...
|
|
|
7083784 |
Molecules with extended half-lives, compositions and uses thereof
The present invention provides molecules, including IgGs, non-IgG immunoglobulin, proteins and non-protein agents, that have increased in vivo half-lives due to the presence of an IgG constant...
|
|
|
7084258 |
Antibodies against the PRO862 polypeptides
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
|
|
|
7084257 |
Fully human antibody Fab fragments with human interferon-gamma neutralizing activity
Selective binding agents of interferon-gamma (IFNγ) are provided by the invention. More particularly, the invention provides for antibodies and antigen binding domains which selectively bind to...
|
|
|
7081519 |
Antibodies to serine protease polypeptides
Antibodies that specifically bind to novel serine protease polypeptides are disclosed. The polypeptides are selected from the group consisting of a polypeptide as shown in SEQ ID NO:2 from residue...
|
|
|
7081521 |
Anti-PRO788 antibodies
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
|
|
|
7081520 |
Anti-pro 1570 antibodies
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
|
|
|
7070774 |
Antibodies that bind testis-specific insulin homolog polypeptides
The present invention provides testis-specific insulin homolog polypeptides and polynucleotides encoding the polypeptides, as well as related compositions and methods are disclosed. The...
|
|
|
7067636 |
Anti-pro 1017 antibodies
The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid...
|
|
|
7067637 |
Antibody or antibody fragments specific for a protein of the TGF-β family
The invention provides antibody and antibody fragments which specifically bind to novel members of the TGF-β family of proteins. The TFG-β family comprises proteins which function as growth...
|
|
|
7067314 |
Monoclonal antibody, its immunoreactive fragment and hybridoma
It is an object to utilize a novel HSCA-3 antigen occurring in immature hemopoietic stem cells and a monoclonal antibody recognizing said antigen in 1) the immunoassay or flow cytometry involving...
|
|
|
7067635 |
Nucleotide and deduced amino acid sequences of tumor gene Int6
The present invention discloses the isolation of the human and murine wild-type Int6 gene and the cDNAs sorresponding to these genes. The invention further describes the use of reagents derived...
|