Match Document Document Title
6911533 Pancreatic progenitor 1 gene and its uses  
Methods for isolating pancreatic progenitor 1 genes are provided. The pancreatic progenitor 1 nucleic acid compositions find use in identifying homologous or related proteins and the DNA sequences...
6887974 Crosslinking agents and methods of use  
Polymeric crosslinking agents are disclosed that have an inert water soluble polymeric component, biodegradable components, functional components reactive with chemical groups on a protein, for...
6878813 Human antithrombin IIIs and methods related thereto  
The present invention discloses modified antithrombin III compounds and methods. The amino acid compounds of the present invention are useful in treating blood clotting disorders, as well as other...
6869934 Method of purifying calcium ion-binding protein  
The present invention relates to a method for purifying a calcium ion-binding protein by cation exchange chromatography. The present invention provide a method for isolating and purifying a calcium...
6867285 Virus-free plasma protein compositions treated with porous membrane and process for producing the same  
Contaminant viruses can be efficiently removed almost without losing the activity of protein by subjecting a plasma protein composition having a high risk of viral contamination to a treatment with...
6864359 Structure-based screening techniques for drug discovery  
The invention relates to novel non-naturally occurring cell surface receptor analogs, ligand analogs and nucleic acids encoding them. The invention further provides methods for screening of ligand...
6846484 DTAT fusion toxin  
The invention provides fusion toxins that contain one or more regions of diphtheria toxin and a portion of urokinase-type plasminogen activator, as well as the nucleic acids that encode the fusion...
6833352 Coagulation factor Viia composition  
The invention relates to a pharmaceutical composition comprising Factor VIIa for subcutan, intramuscular or interdermal administration. Factor VIIa administered subcutanously, intramuscularly or...
6828323 Isoalloxazine derivatives to neutralize biological contaminants  
Methods are provided for neutralization of microorganisms in fluids or on surfaces. Preferably the fluids contain blood or blood products and comprise biologically active proteins. Preferred...
6828422 Protein/(poly)peptide libraries  
The present invention relates to synthetic DNA sequences which encode one or more collections of homologous proteins/(poly)peptides, and methods for generating and applying libraries of these DNA...
6828114 Monoclonal antibody against apolipoprotein A-I  
The present invention is drawn to a monoclonal antibody reacting specfically with (1) apoA-I occurring in HDL containing no apoA-II and having a molecular weight of 150,000 or less; and (2) apoA-I...
6808706 Method for keeping the quality of aqueous parenteral solution of thrombomodulin in storage and distribution  
A method for keeping the quality of an aqueous parenteral solution of thrombomodulin which is not in a frozen or freeze-dried state but in a liquid form in storage and distribution, characterized...
6797806 Fragments of CR1 and their use  
A polypeptide comprising a portion of the sequence of the general formula (I): CNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSG, of 6-23 amino acids in length and comprising sequence a) and/or b): a) GGRKVF, b)...
6790625 Antibodies to placental protein 13  
A monoclonal antibody (Mab) capable of binding Placental Protein 13 (pp-13) is disclosed. Also disclosed are hybridoma clone producing the Mab, an immunoassay using the Mab for measuring the level...
6780609 High bone mass gene of 1.1q13.3  
The present invention relates to methods and materials used to isolate and detect a high bone mass gene and a corresponding wild-type gene, and mutants thereof. The present invention also relates...
6780842 Ceruloplasmin and an antioxidant composition comprising the same and their uses as neuroprotective agent  
A neuroprotective composition for protecting neuronal cells against oxidative stress and methods for using and preparing the same. More particularly, the neuroprotective composition of the...
6759216 Glycosylated, low antigenicity low immunogenicity factor VIII  
The development of inhibitory antibodies to blood coagulation factor VIII (fVIII) results in a severe bleeding tendency. These antibodies arise in patients with hemophilia A (hereditary fVIII...
6759384 Factor Xa inhibitors  
The invention provides compounds which specifically inhibit factor Xa activity having the structure A 1 —A 2 —(A 3 ) m —B, where m is 0 or 1. A compound of the invention is characterized, in...
6750025 Method of detecting and isolating prion protein and variants thereof  
The present invention provides for a novel method of detecting the prion protein and variants thereof which utilizes specific amino acid binding sequences. Specifically, the present invention...
6750323 Platelet activation protein  
A substantially pure platelet activation polypeptide including a sequence at least 70% identical to SEQ ID NO:1, and a DNA encoding such a polypeptide.
6747136 Human monoclonal antibodies specific for hepatitis C virus (HCV) E2 antigen  
The present invention relates to compositions derived from immunoglobulin molecules specific for the hepatitis C virus (HCV). More particularly, the invention is related to molecules which are...
6740736 Purification of fibrinogen from milk by use of cation exchange chromatography  
Fibrinogen is obtained from milk by contact with a cation exchange chromatography substrate under conditions where the fibrinogen binds to the substrate, followed by optional washing of the...
6706861 Reconstitution of purified membrane proteins into preformed liposomes  
The present application relates to a method of making liposomes having membrane proteins incorporated therein, the method comprising: providing the membrane protein in solution; providing a...
6706682 Uses of vascular endothelial growth factor in the treatment of erectile dysfunction  
This invention provides a method of increasing or maintaining the blood supply in the penis of a male subject which comprises administering to the subject an amount of vascular endothelial growth...
6703219 Mutant protein and methods and materials for making and using it  
The invention provides a mutant protein which has the same amino acid sequence as an unmutated C-reactive protein (CRP) subunit or an unmutated preCRP, except that at least one amino acid of the...
6693173 Method to remove citrate and aluminum from proteins  
A method is provided for removing citrate, aluminum, and other multivalent ions and contaminants from proteins by adjusting the pH of a solution containing the protein to a pH from about 7 to about...
RE38431 Methods of production and use of liquid formulations of plasma proteins  
The present invention relates to the preparation and use of liquid formulations of plasma proteins, particularly blood coagulation factors. More specifically, the present invention relates to...
6683159 Methods for producing factor VIII proteins  
Methods are provided for purification of Factor VIII polypeptides by immunoaffinity chromatography and ion exchange chromatography, in which the eluate from the immunoaffinity column is diluted...
6676943 Human complement C3-degrading protein from Streptococcus pneumoniae  
The present invention relates to the identification and use of a family of human complement C3-degrading proteinases expressed by S. pneumoniae . The proteinase has a molecular weight of about 24...
6677440 Process for the preparation in pure form of the protease activating blood clotting factor VII, its proenzyme or a mixture of both proteins by means of ion-exchange chromatography  
A process for the preparation of a pure form of protein, wherein the protein is protease activating blood clotting factor VII, the proenzyme for the protease, or a mixture of both the-protease and...
6673629 Neutralization of polycations in a chromatographic device for whole blood use  
A chromatography assay device and method for use with whole blood samples utilizing a red blood cell separating agent to aggregate red blood cells and permit plasma or serum to flow by capillary...
6660492 Chimeric serine proteases  
A chimeric serine protease whose protease domain is composed of two domain halves (half-sides) with a β-folded sheet structure, wherein the first domain half corresponds to the first domain half...
6657047 Human Pelota homolog  
68772 polypeptides and polynucleotides and methods for producing such polypeptides by recombinant techniques are disclosed. Also disclosed are methods for utilizing 68772 polypeptides and...
6627193 Methods and compositions for control of blood coagulation  
Methods for controlling blood coagulation, and suitable pharmaceutical compositions that include a polypeptide that enhances the anticoagulation process (or inhibitors thereof for reversing the...
6613532 Anti-lamin antibodies, endogeneous inhibitors of thrombosis  
The present invention relates to a method to determine predisposition to coagulation disorders, such as thrombosis, to a method for diagnosis of lupus, and therapeutical uses thereof in the...
6610825 Method for alleviating pain or providing an analgesic effect in a patient  
Conjugates are prepared from antinociceptive agents, particularly opioids or opioid analogs, more particularly dynorphins, endorphins, deltorphins, enkephalins or analogs thereof, by combining said...
6607897 Recombinant proCVF  
Recombinant proCVF exhibits substantially the same activity as CVF and is useful for lowering complement activity.
6602981 Antinociceptive agent derivative  
Conjugates are prepared from antinociceptive agents, particularly opioids or opioid analogs, more particularly dynorphins, endorphins, deltorphins, enkephalins or analogs thereof, by combining said...
6599507 Composition for the treatment of immune deficiencies and methods for its preparation and use  
A complex of alpha-fetoprotein (AFP) and N-arachidonoyl aminoethyl phosphate (N-AAP) is shown to have significant immunostimulating properties and can therefore be used as a therapeutic agent in...
6596689 Therapeutic method using fucose-containing proteoglycan or acidic glycan  
A class of proteoglycans containing fucosylated acidic glycans, e.g., as produced by marine sponges and sea urchin embryos, have been found to stimulate selective proliferation of mammalian natural...
6596847 Tissue factor protein variants  
The invention provides amino acid sequence variants of tissue factor protein. The tissue factor protein variants have a greater affinity for Factor VII/VIIa than wild-type counterparts. The...
6579723 Method of recovering highly purified vWF or factor VIII/vWF-complex  
A method for purifying factor VIII/vWF complex or free vWF by immunoaffinity chromatography in a form suitable for use as a medicament. Factor VIII/vWF complex or free vWF is recovered from an...
6576610 Use of a context-dependent functional entity to enhance the efficacy of an agent  
The present invention relates to a method of enhancing the efficacy of one or more agents in a subject by administering the agent or agents and a context-dependent functional entity to the subject,...
6576609 Methods and compositions for generating angiostatin  
The invention provides a method of treating a neoplastic disease in a human by administering a therapeutically effective amount of plasminogen activator effective to increase the amount of...
6562598 Factor X deletion mutants and analogues thereof  
Factor XΔ analogues are provided, as well as pharmaceutical preparations containing such analogues and methods of preparing such analogues. The factor XΔ analogues have a deletion of the amino...
6558687 Fibrin polymer structure  
In accordance with the present invention a novel fibrin polymer structure is disclosed. The novel fibrin polymer structure useful, for example, as a surgical sealant, is comprised of a plurality of...
6548646 Reference control for high-sensitivity C-reactive protein testing  
Low-concentration reference controls for C-reactive protein assays are prepared from higher-level starting materials by simple filtration using silica-type filter media formerly used for removing...
6534640 Methods and compositions to alter the cell surface expression of phosphatidylserine and other clot-promoting plasma membrane phospholipids  
A protein preparation that mediates Ca +2 transbilayer movement of phospholipid is disclosed. Additionally, a modified or mutated protein preparation, wherein the protein has a reduced ability to...
6534035 Methods of inhibiting clot formation  
The invention provides methods of detecting blood in vivo and methods of inhibiting clot formation and promoting therapeutic thrombolysis using alpha-2 antiplasmin (α2AP) polypeptides.
6531577 von Willebrand factor (vWF)-containing preparation, process for preparing vWF-containing preparations, and use of such preparations  
A high-purity von Willebrand factor preparation, a process for making it, and use of the preparation and compositions containing it for the treatment of disorders are disclosed.