Match Document Document Title
7538187 Coloring compositions with peptide-based dispersants and binders  
Coloring compositions comprising peptide-based dispersants and/or binders are provided. The compositions are particularly useful for the coloring or dyeing of substrates such as paper and textile...
7538090 Exogenous surfactant protein B mimic  
A composition including a C terminal region having residues corresponding to a peptide identified by PDB ID: 1RG3; an N terminal region having residues corresponding to a peptide identified by PDB...
7537771 Expression system  
An immunogenic reagent which produces an immune response which is protective against Bacillus anthracis, said reagent comprising one or more polypeptides which together represent up to three...
7537772 Chlamydia protein, gene sequence and the uses thereof  
The invention discloses the Chlamydia PMPE and PMPI polypeptide, polypeptides derived thereof (PMP-derived polypeptides), nucleotide sequences encoding said polypeptides, antibodies that...
7538185 Glucagon-like peptide-1 analogs with long duration of action  
Novel GLP-1 analogs having improved biological potency as well as extended pharmacological activity are described herein. More specifically, the present invention relates to GLP-1 analogs (28 or 29...
7538186 Exendins and exendin agonists modified with polyamino acids  
Modified exendins and exendin agonists having an exendin or exendin agonist linked to one or more molecular weight increasing compounds, for example, polyamino acids, polyethylene glycol polymers,...
7538088 Method for inhibiting angiogenesis by administration of the extracellular domain of D1-1 polypeptide  
The disclosure provides, among other things, novel angiogenesis-related nucleic acids, polypeptides and methods of use.
7538087 Agent against periodontal disease  
The present invention relates to a product for preventing periodontal disease wherein the product includes or is based on a Cystatin type peptide. The invention also relates to dentifrice...
7538089 Anti-inflammatory compounds and uses thereof  
The present invention provides anti-inflammatory compounds, pharmaceutical compositions thereof, and methods of use thereof for treating inflammatory disorders. The present invention also provides...
7534436 Peptide fragments of the harp factor inhibiting angiogenesis  
The invention concerns peptide fragments 13-39 and 65-97 of the HARP factor, which inhibit angiogenesis. Advantageously, said peptides can be associated with the peptide 111-136 of HARP. The...
7531512 Method of use of peptide antagonists of zonulin to prevent or delay the onset of diabetes  
A method for preventing or delaying the onset of autoimmune diseases is disclosed.
7531502 Diagnostic conjugate useful for intracellular imaging and for differentiating between tumor- and non-tumor cells  
Described is a diagnostic conjugate comprising (a) a transmembrane module (TPU), (b) an address module (AS), preferably an antisense peptide nucleic acid (PNA), and (c) a signaling module (SM). The...
7531509 Papillosin antimicrobial peptide, a gene coding said peptide, a vector, a transformed organism and a compound containing said organism  
An antimicrobial peptide isolated from an extract from a marine invertebrate, whose amino acid sequence is as follows: GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ (SEQ ID No. 1), its derivatives, its...
7531515 Peptides selectively lethal to malignant and transformed mammalian cells  
The present invention provides peptides corresponding to all or a portion of amino acid residues 12-26 of human p53 protein, which peptides are lethal to malignant or transformed cells when fused...
7531621 PTH2 receptor selective compounds  
This invention relates to a series of PTH and PTHrP analogues that selectively bind to PTH2 receptors and as such may be useful in treating abnormal CNS functions; abnormal pancreatic functions;...
7528104 Peptides that bind to the erythropoietin receptor  
The present invention relates to peptide compounds that are agonists of the erythropoietin receptor (EPO-R). The invention also relates to therapeutic methods using such peptide compounds to treat...
7528109 Pleiotrophin growth factor receptor for the treatment of proliferative, vascular and neurological disorders  
This invention relates to the discovery that pleiotrophin binds to and activates a pleiotrophin-receptor which is responsible for the events associated with pleiotrophin activity including...
7527787 Multivalent immunoglobulin-based bioactive assemblies  
The present invention concerns methods and compositions for stably tethered structures of defined compositions, which may have multiple functionalities and/or binding specificities. Preferred...
7524663 Covalently reactive transition state analogs and methods of use thereof  
Improved methods for the production, selection and inhibition of catalytic antibodies are disclosed.
7524812 Pharmaceutical formulation comprising ziconotide  
The present invention is direct to a method of producing analgesia in a mammalian subject. The method includes administering to the subject an omega conopeptide, preferably ziconotide, in...
7524813 Selectively conjugated peptides and methods of making the same  
Methods for the selective conjugation of peptides which comprises an enzymatic incorporation of a functional group at the C-terminal end of a peptide followed by reaction with a second compound...
7521527 GLP-1 pharmaceutical compositions  
The present invention is directed to peptide analogues of glucagon-like peptide-1, the pharmaceutically-acceptable salts thereof, to methods of using such analogues to treat mammals and to...
7521528 Conformationally constrained parathyroid hormone (PTH) analogs with lactam bridges  
The present invention relates to methods of treatment of mammalian conditions characterized by decreases in bone mass with conformationally constrained parathyroid hormone (PTH) analogs and...
7521529 Differentially protected orthogonal lanthionine technology  
The present invention provides a method of synthesizing an intramolecularly bridged polypeptide comprising at least one intramolecular bridge. The present invention further provides a method of...
7517951 Marker proteins for diagnosing liver disease and method of diagnosing liver disease using the same  
Using the protein chip technology, biological samples such as sera are subjected to proteome analysis. Thus, a protein which is a human fibrinogen α-E chain decomposition product and has a...
7517855 Peptides which inhibit angiogenesis, cell migration, cell invasion and cell proliferation, compositions and uses thereof  
The present invention relates generally to peptides, which inhibit angiogenesis, cell migration, cell invasion and cell proliferation, methods of making peptides, which inhibit angiogenesis, cell...
7517655 Protein capable of deposition onto extracellular matrix  
The present invention provides the following partial fragment (a) or (b) of developmentally regulated endothelial cell locus-1 (Del-1) protein: (a) a protein consisting of the amino acid sequence...
7514530 Peptide carrier for delivering siRNA into mammalian cells  
Complex comprising a peptide carrier of SEQ ID NO:1 GALFLGFLGAAGSTMGAWSQPKR 1 KRKVR 2 and an appropriate siRNA, wherein R 1 represents any amino acid residue and more preferably K or S, R 2 is...
7514403 Process for the stabilization of proteins in an aqueous solution comprising cysteine in a concentration between 150 and 220mM  
The present invention relates to a process for the storage of proteins in an aqueous solution. The addition of cysteine delays the temporal decrease in the effective concentration of the protein....
7514532 Mutant IGFBP-3 molecules that do not bind to IGFS, but retain their ability to functionally bind IGFBP-3 receptor  
There is disclosed novel mutant IGFBP-3 polypeptides and fragments thereof that have either no binding, or diminished binding to IGFs, yet retain their ability to bind to the human IGFBP-3 receptor...
7514407 Spheron component peptides and pharmaceutical compositions  
The present invention relates to racemized proteins and racemized protein components of spherons that are useful for identifying compounds capable of preventing and/or ameliorating symptoms of...
7514531 Specific binding sites in collagen for integrins and use thereof  
The present invention identified a high affinity binding sequence in collagen type III for the collagen-binding integrin I domains. Provided herein are the methods used to characterize the...
7511012 Myostatin binding agents  
The present invention provides binding agents comprising peptides capable of binding myostatin and inhibiting its activity. In one embodiment the binding agent comprises at least one...
7507420 Peptidyl prodrugs and linkers and stabilizers useful therefor  
The present invention provides analogues of duocarmycins that are potent cytotoxins. Also provided are peptidyl and disulfide linkers that are cleaved in vivo. The linkers are of use in forming...
7507713 Motoneuronotrophic factor  
The present invention is directed to a novel purified polypeptide consisting of an amino acid sequence as set forth in SEQ ID NO: 4, one of the member of the Motoneuronotrophic Factor family which...
7507714 Pituitary adenylate cyclase activating peptide (PACAP) receptor 3 (R3) agonists and their pharmacological methods of use  
This invention provides novel peptides that function in vivo to stimulate insulin release from pancreatic beta cells in a glucose-dependent fashion. These insulin secretagogue peptides are shown to...
7507550 Analytical sandwich test for determining NT-proBNP  
The present invention concerns an immunological test for determining NT-proBNP comprising at least two antibodies to NT-proBNP, wherein at least one of the antibodies to NT-proBNP is a monoclonal...
7501486 Peptides that selectively home to heart vasculature and related conjugates and methods  
The present invention provides a variety of isolated peptides and peptidomimetics, which can be useful, for example, in constructing the conjugates of the invention or, where the peptide itself has...
7501485 Bioactive keratin peptides  
Compositions containing biologically active peptides are disclosed. Active peptides are isolated fragments derived from human hair or sheep wool keratin proteins. Compositions may be prepared for...
7498306 Peptides binding to the phosphatase 2A protein  
The invention relates to novel synthetic or natural E4orf4 or Bcl-2 peptides particularly useful in antitumoral, antiviral and antiparasitic treatments, said peptides being less than 30 amino acids...
7498413 Maize antimicrobial protein useful for enhancing plant resistance to pathogens  
Compositions and methods for protecting a plant from a pathogen, particularly a fungal pathogen, are provided. Compositions include novel amino acid sequences, and variants and fragments thereof,...
7498308 Method of treating a subject suffering stroke comprising administering Glucagon-like peptide-1 analogs  
Disclosed are glucagon-like peptide-1 (GLP-1) compounds with modifications at one or more of the following positions: 11, 12, 16, 22, 23, 24, 25, 27, 30, 33, 34, 35, 36, or 37. Methods of treating...
7498307 Combinations of DnaK inhibitors with known antibacterial agents  
Compositions, methods and kits are provided comprising (a) a therapeutically effective amount of a DnaK inhibitor; and (b) a therapeutically effective amount of a known antibacterial agent. Such...
7494976 Caveolin peptides and their use as therapeutics  
The present invention relates generally to compositions and methods useful for treating various conditions and afflictions, such as inflammation and cancer. More specifically, the present invention...
7495070 Protein binding miniature proteins  
The present invention provides a protein scaffold, such as an avian pancreatic polypeptide, that can be modified by substitution of two or more amino acid residues that are exposed on the alpha...
7491701 Peptides that bind to HSP90 proteins  
YSLPGYMVKKLLGA (SEQ ID NO:1) and its active analogs, compositions, and methods of use.
7491699 Peptide nanostructures and methods of generating and using the same  
A tubular or spherical nanostructure composed of a plurality of peptides, wherein each of the plurality of peptides includes no more than 4 amino acids and whereas at least one of the 4 amino acids...
7488713 Cancer treatment using C-type natriuretic peptides  
The present invention includes a method of utilizing four peptide hormones to inhibit the growth of cancer(s). A dramatic decrease in the number of human pancreatic adenocarcinoma cells (i.e., the...
7488716 Peptides acting as both GLP-1 receptor agonists and glucagon receptor antagonists and their pharmacological methods of use  
The invention provides polypeptides that act both as an agonist of the GLP-1 receptor and an antagonist of the glucagon receptor. Such polypeptides are useful for treating individuals with type 2...
7488481 Polypeptides derived from anti-HIV-1 gp120 antibodies that abrogate gp120 binding to CCR5  
The present invention is directed to peptides that are capable of blocking the entry of HIV-1 into host cells by means of the CCR5 receptor. The affinity of the peptides for gp120 on the HIV viral...