|
Match
|
Document |
Document Title |
|
|
7538187 |
Coloring compositions with peptide-based dispersants and binders
Coloring compositions comprising peptide-based dispersants and/or binders are provided. The compositions are particularly useful for the coloring or dyeing of substrates such as paper and textile...
|
|
|
7538090 |
Exogenous surfactant protein B mimic
A composition including a C terminal region having residues corresponding to a peptide identified by PDB ID: 1RG3; an N terminal region having residues corresponding to a peptide identified by PDB...
|
|
|
7537771 |
Expression system
An immunogenic reagent which produces an immune response which is protective against Bacillus anthracis, said reagent comprising one or more polypeptides which together represent up to three...
|
|
|
7537772 |
Chlamydia protein, gene sequence and the uses thereof
The invention discloses the Chlamydia PMPE and PMPI polypeptide, polypeptides derived thereof (PMP-derived polypeptides), nucleotide sequences encoding said polypeptides, antibodies that...
|
|
|
7538185 |
Glucagon-like peptide-1 analogs with long duration of action
Novel GLP-1 analogs having improved biological potency as well as extended pharmacological activity are described herein. More specifically, the present invention relates to GLP-1 analogs (28 or 29...
|
|
|
7538186 |
Exendins and exendin agonists modified with polyamino acids
Modified exendins and exendin agonists having an exendin or exendin agonist linked to one or more molecular weight increasing compounds, for example, polyamino acids, polyethylene glycol polymers,...
|
|
|
7538088 |
Method for inhibiting angiogenesis by administration of the extracellular domain of D1-1 polypeptide
The disclosure provides, among other things, novel angiogenesis-related nucleic acids, polypeptides and methods of use.
|
|
|
7538087 |
Agent against periodontal disease
The present invention relates to a product for preventing periodontal disease wherein the product includes or is based on a Cystatin type peptide. The invention also relates to dentifrice...
|
|
|
7538089 |
Anti-inflammatory compounds and uses thereof
The present invention provides anti-inflammatory compounds, pharmaceutical compositions thereof, and methods of use thereof for treating inflammatory disorders. The present invention also provides...
|
|
|
7534436 |
Peptide fragments of the harp factor inhibiting angiogenesis
The invention concerns peptide fragments 13-39 and 65-97 of the HARP factor, which inhibit angiogenesis. Advantageously, said peptides can be associated with the peptide 111-136 of HARP. The...
|
|
|
7531512 |
Method of use of peptide antagonists of zonulin to prevent or delay the onset of diabetes
A method for preventing or delaying the onset of autoimmune diseases is disclosed.
|
|
|
7531502 |
Diagnostic conjugate useful for intracellular imaging and for differentiating between tumor- and non-tumor cells
Described is a diagnostic conjugate comprising (a) a transmembrane module (TPU), (b) an address module (AS), preferably an antisense peptide nucleic acid (PNA), and (c) a signaling module (SM). The...
|
|
|
7531509 |
Papillosin antimicrobial peptide, a gene coding said peptide, a vector, a transformed organism and a compound containing said organism
An antimicrobial peptide isolated from an extract from a marine invertebrate, whose amino acid sequence is as follows:
GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ (SEQ ID No. 1), its derivatives, its...
|
|
|
7531515 |
Peptides selectively lethal to malignant and transformed mammalian cells
The present invention provides peptides corresponding to all or a portion of amino acid residues 12-26 of human p53 protein, which peptides are lethal to malignant or transformed cells when fused...
|
|
|
7531621 |
PTH2 receptor selective compounds
This invention relates to a series of PTH and PTHrP analogues that selectively bind to PTH2 receptors and as such may be useful in treating abnormal CNS functions; abnormal pancreatic functions;...
|
|
|
7528104 |
Peptides that bind to the erythropoietin receptor
The present invention relates to peptide compounds that are agonists of the erythropoietin receptor (EPO-R). The invention also relates to therapeutic methods using such peptide compounds to treat...
|
|
|
7528109 |
Pleiotrophin growth factor receptor for the treatment of proliferative, vascular and neurological disorders
This invention relates to the discovery that pleiotrophin binds to and activates a pleiotrophin-receptor which is responsible for the events associated with pleiotrophin activity including...
|
|
|
7527787 |
Multivalent immunoglobulin-based bioactive assemblies
The present invention concerns methods and compositions for stably tethered structures of defined compositions, which may have multiple functionalities and/or binding specificities. Preferred...
|
|
|
7524663 |
Covalently reactive transition state analogs and methods of use thereof
Improved methods for the production, selection and inhibition of catalytic antibodies are disclosed.
|
|
|
7524812 |
Pharmaceutical formulation comprising ziconotide
The present invention is direct to a method of producing analgesia in a mammalian subject. The method includes administering to the subject an omega conopeptide, preferably ziconotide, in...
|
|
|
7524813 |
Selectively conjugated peptides and methods of making the same
Methods for the selective conjugation of peptides which comprises an enzymatic incorporation of a functional group at the C-terminal end of a peptide followed by reaction with a second compound...
|
|
|
7521527 |
GLP-1 pharmaceutical compositions
The present invention is directed to peptide analogues of glucagon-like peptide-1, the pharmaceutically-acceptable salts thereof, to methods of using such analogues to treat mammals and to...
|
|
|
7521528 |
Conformationally constrained parathyroid hormone (PTH) analogs with lactam bridges
The present invention relates to methods of treatment of mammalian conditions characterized by decreases in bone mass with conformationally constrained parathyroid hormone (PTH) analogs and...
|
|
|
7521529 |
Differentially protected orthogonal lanthionine technology
The present invention provides a method of synthesizing an intramolecularly bridged polypeptide comprising at least one intramolecular bridge. The present invention further provides a method of...
|
|
|
7517951 |
Marker proteins for diagnosing liver disease and method of diagnosing liver disease using the same
Using the protein chip technology, biological samples such as sera are subjected to proteome analysis. Thus, a protein which is a human fibrinogen α-E chain decomposition product and has a...
|
|
|
7517855 |
Peptides which inhibit angiogenesis, cell migration, cell invasion and cell proliferation, compositions and uses thereof
The present invention relates generally to peptides, which inhibit angiogenesis, cell migration, cell invasion and cell proliferation, methods of making peptides, which inhibit angiogenesis, cell...
|
|
|
7517655 |
Protein capable of deposition onto extracellular matrix
The present invention provides the following partial fragment (a) or (b) of developmentally regulated endothelial cell locus-1 (Del-1) protein: (a) a protein consisting of the amino acid sequence...
|
|
|
7514530 |
Peptide carrier for delivering siRNA into mammalian cells
Complex comprising a peptide carrier of SEQ ID NO:1 GALFLGFLGAAGSTMGAWSQPKR 1 KRKVR 2 and an appropriate siRNA, wherein R 1 represents any amino acid residue and more preferably K or S, R 2 is...
|
|
|
7514403 |
Process for the stabilization of proteins in an aqueous solution comprising cysteine in a concentration between 150 and 220mM
The present invention relates to a process for the storage of proteins in an aqueous solution. The addition of cysteine delays the temporal decrease in the effective concentration of the protein....
|
|
|
7514532 |
Mutant IGFBP-3 molecules that do not bind to IGFS, but retain their ability to functionally bind IGFBP-3 receptor
There is disclosed novel mutant IGFBP-3 polypeptides and fragments thereof that have either no binding, or diminished binding to IGFs, yet retain their ability to bind to the human IGFBP-3 receptor...
|
|
|
7514407 |
Spheron component peptides and pharmaceutical compositions
The present invention relates to racemized proteins and racemized protein components of spherons that are useful for identifying compounds capable of preventing and/or ameliorating symptoms of...
|
|
|
7514531 |
Specific binding sites in collagen for integrins and use thereof
The present invention identified a high affinity binding sequence in collagen type III for the collagen-binding integrin I domains. Provided herein are the methods used to characterize the...
|
|
|
7511012 |
Myostatin binding agents
The present invention provides binding agents comprising peptides capable of binding myostatin and inhibiting its activity. In one embodiment the binding agent comprises at least one...
|
|
|
7507420 |
Peptidyl prodrugs and linkers and stabilizers useful therefor
The present invention provides analogues of duocarmycins that are potent cytotoxins. Also provided are peptidyl and disulfide linkers that are cleaved in vivo. The linkers are of use in forming...
|
|
|
7507713 |
Motoneuronotrophic factor
The present invention is directed to a novel purified polypeptide consisting of an amino acid sequence as set forth in SEQ ID NO: 4, one of the member of the Motoneuronotrophic Factor family which...
|
|
|
7507714 |
Pituitary adenylate cyclase activating peptide (PACAP) receptor 3 (R3) agonists and their pharmacological methods of use
This invention provides novel peptides that function in vivo to stimulate insulin release from pancreatic beta cells in a glucose-dependent fashion. These insulin secretagogue peptides are shown to...
|
|
|
7507550 |
Analytical sandwich test for determining NT-proBNP
The present invention concerns an immunological test for determining NT-proBNP comprising at least two antibodies to NT-proBNP, wherein at least one of the antibodies to NT-proBNP is a monoclonal...
|
|
|
7501486 |
Peptides that selectively home to heart vasculature and related conjugates and methods
The present invention provides a variety of isolated peptides and peptidomimetics, which can be useful, for example, in constructing the conjugates of the invention or, where the peptide itself has...
|
|
|
7501485 |
Bioactive keratin peptides
Compositions containing biologically active peptides are disclosed. Active peptides are isolated fragments derived from human hair or sheep wool keratin proteins. Compositions may be prepared for...
|
|
|
7498306 |
Peptides binding to the phosphatase 2A protein
The invention relates to novel synthetic or natural E4orf4 or Bcl-2 peptides particularly useful in antitumoral, antiviral and antiparasitic treatments, said peptides being less than 30 amino acids...
|
|
|
7498413 |
Maize antimicrobial protein useful for enhancing plant resistance to pathogens
Compositions and methods for protecting a plant from a pathogen, particularly a fungal pathogen, are provided. Compositions include novel amino acid sequences, and variants and fragments thereof,...
|
|
|
7498308 |
Method of treating a subject suffering stroke comprising administering Glucagon-like peptide-1 analogs
Disclosed are glucagon-like peptide-1 (GLP-1) compounds with modifications at one or more of the following positions: 11, 12, 16, 22, 23, 24, 25, 27, 30, 33, 34, 35, 36, or 37. Methods of treating...
|
|
|
7498307 |
Combinations of DnaK inhibitors with known antibacterial agents
Compositions, methods and kits are provided comprising (a) a therapeutically effective amount of a DnaK inhibitor; and (b) a therapeutically effective amount of a known antibacterial agent. Such...
|
|
|
7494976 |
Caveolin peptides and their use as therapeutics
The present invention relates generally to compositions and methods useful for treating various conditions and afflictions, such as inflammation and cancer. More specifically, the present invention...
|
|
|
7495070 |
Protein binding miniature proteins
The present invention provides a protein scaffold, such as an avian pancreatic polypeptide, that can be modified by substitution of two or more amino acid residues that are exposed on the alpha...
|
|
|
7491701 |
Peptides that bind to HSP90 proteins
YSLPGYMVKKLLGA (SEQ ID NO:1) and its active analogs, compositions, and methods of use.
|
|
|
7491699 |
Peptide nanostructures and methods of generating and using the same
A tubular or spherical nanostructure composed of a plurality of peptides, wherein each of the plurality of peptides includes no more than 4 amino acids and whereas at least one of the 4 amino acids...
|
|
|
7488713 |
Cancer treatment using C-type natriuretic peptides
The present invention includes a method of utilizing four peptide hormones to inhibit the growth of cancer(s). A dramatic decrease in the number of human pancreatic adenocarcinoma cells (i.e., the...
|
|
|
7488716 |
Peptides acting as both GLP-1 receptor agonists and glucagon receptor antagonists and their pharmacological methods of use
The invention provides polypeptides that act both as an agonist of the GLP-1 receptor and an antagonist of the glucagon receptor. Such polypeptides are useful for treating individuals with type 2...
|
|
|
7488481 |
Polypeptides derived from anti-HIV-1 gp120 antibodies that abrogate gp120 binding to CCR5
The present invention is directed to peptides that are capable of blocking the entry of HIV-1 into host cells by means of the CCR5 receptor. The affinity of the peptides for gp120 on the HIV viral...
|