Matches 1 - 33 out of 33
Match Document Document Title
7592418 Biocompatible crosslinked polymers with visualization agents  
Biocompatible crosslinked polymers, and methods for their preparation and use, are disclosed in which the biocompatible crosslinked polymers are formed from water soluble precursors having...
7332566 Biocompatible crosslinked polymers with visualization agents  
Biocompatible crosslinked polymers, and methods for their preparation and use, are disclosed in which the biocompatible crosslinked polymers are formed from water soluble precursors having...
7291697 Resinates from monomer  
Reduced-rosin compositions of printing inks and the resinate binders therein, and the processes of preparation thereof, are described. In said compositions, a portion of the rosin normally used in...
7112653 Composition and method for preserving progenitor cells  
The invention relates to a protein material which is effective to preserve progenitor cells, such as hematopoietic progenitor cells. The protein has an amino acid sequence comprising AQSLSFSFTKFD...
7037674 Cytochrome P450 reductases from poppy plants  
The present invention relates to production of alkaloids from poppy plants and in particular togenes encoding enzymes in the alkaloid pathway, to proteins encoded by the gens, to plants transformed...
7009034 Biocompatible crosslinked polymers  
Biocompatible crosslinked polymers, and methods for their preparation and use, are disclosed in which the biocompatible crosslinked polymers are formed from water soluble precursors having...
6887974 Crosslinking agents and methods of use  
Polymeric crosslinking agents are disclosed that have an inert water soluble polymeric component, biodegradable components, functional components reactive with chemical groups on a protein, for...
6844420 Natural resin formulations  
This invention is directed to a method of preparing a natural resin by liquefying wood, bark, forest residues, wood industry residues, or other biomass using rapid destructive distillation (fast...
6706858 Use of alkanes for contamination-free purification or separation of biopolymers  
The present invention relates to the use of alkanes for the contamination-free purification or separation of biopolymers.
6555649 Natural resin formulations  
This invention is directed to a method of preparing a natural resin by liquefying wood, bark, forest residues, wood industry residues, or other biomass using rapid destructive distillation (fast...
6326461 Natural resin formulations  
This invention is directed to a method of preparing a natural resin by liquefying wood, bark, forest residues, wood industry residues, or other biomass using rapid destructive distillation (fast...
6280724 Composition and method for preserving progenitor cells  
The invention relates to a protein material which is effective to preserve progenitor cells, such as hematopoietic progenitor cells. The protein has an amino acid sequence comprising AQSLSFSFTKFD...
6228623 Polyhydroxyalkanoates of narrow molecular weight distribution prepared in transgenic plants  
Methods for the biosynthesis of polyhydroxyalkanoate homopolymers and copolymers are described. In a preferred embodiment, the polymers have a single mode molecular weight distribution, and more...
6146842 High-throughput screening assays utilizing metal-chelate capture  
A high throughput enzyme screen has been developed which relies on metal chelate interaction for capture of the product of the enzymatic reaction. In the present assay system, a detectable moiety...
5981469 78 residue polypeptide (NK-lysine) and its use  
A 78 residue polypeptide comprising the following amino acid sequence GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDI LTGKK PQAICVDIKICKE ...
5922324 Propolis extract with improved water-solubility  
A propolis extract which is prepared by adjusting the pH of propolis to 5.5-7.0 to improve the water-solubility of the effective ingredients of propolis, a composition containing the propolis...
5821285 Method of preparing filler containing forms of chitin  
The method relates to the preparation of dry chitin forms of consistent shape that incorporates an advantageous additive such as fillers or reinforcement during the preparation process to give dry...
5703040 Broad spectrum antibiotic peptide  
Improved antimicrobial proteinaceous substances produced by Staphylococcus aureus KSI1829 (e.g., Bac1829) and methods of inhibiting microbial growth using such substances are disclosed.
5698668 Modified natural-resin acid esters, processes for their preparation, and their use as binder resins in printing inks  
Toluene-soluble modified natural-resin acid esters which can be prepared by reacting at least one compound from each of the component groups: A) natural resins or natural-resin acids; B)...
5691154 Enzyme linked immunoassay with stabilized polymer saccharide enzyme conjugates  
An improvement in enzyme linked immunoassays is disclosed wherein the enzyme is in the form of a water soluble polymer saccharide conjugate which is stable in hostile environments. The conjugate...
5621072 Purified guaiacum resin and method for making same  
A purified guaiacum resin which is obtained by isolation from a natural guaiacum resin with chromatography using a gel for reversed chromatography as a stationary phase and a polar solvent as a...
5556454 Modified natural resin esters, processes for their preparation and their use as binder resins in printing inks  
Toluene-soluble modified natural resin esters suitable as binder resins in ground pigments and printing inks for halftone gravure printing prepared by reacting at least one compound from each of...
5492821 Stabilized polyacrylic saccharide protein conjugates  
This invention is directed to water soluble protein polymer conjugates which are stabile in hostile environments. The conjugate comprises a protein which is linked to an acrylic polymer at multiple...
5157109 Preparation of novel synthetic resins  
A process for the preparation of novel resin comprising reacting cyclopentadienes, preferably dicyclopentadienes, with tall oil pitch or a neutrals-containing component thereof, at a temperature...
5130419 Process for preparing lignocellulosic bodies  
Process for preparing lignocellulosic bodies by bringing lignocellulosic parts into contact with a composition comprising a polyisocyanate, fumed silica and a non-ionic liquid gellant and by...
5049652 Use of a mixed catalyst system to improve the viscosity stability of rosin resins  
Rosin esters having improved viscosity stability are prepared by heating a mixture of rosin and a polyol in the presence of a catalyst mixture of 0.1% to 0.6% by weight calcium bis(ethyl...
4876331 Copolyester and process for producing the same  
According to the present invention, a novel copolyester comprising 3-hydroxybutyrate unit, 3-hydroxyvalerate unit and 5-hydroxyvalerate unit; 3-hydroxybutyrate unit and 4-hydroxybutyrate unit; or...
4806285 Hydrogenated grindelia acids and their methyl, glycerol and pentaerythritol esters  
Novel diterpene compounds are separated from dry biomass of Grindelia camporum. The separated compounds are then hydrogenated and esterified. Both the hydrogenated and ester products are useful as...
4382886 Method for extracting propolis and water soluble dry propolis powder  
A new and useful method for extracting propolis from substantially clean raw material to obtain a dry propolis powder. Depending upon the method employed, either a water soluble propolis powder or...
4297271 Guaiaconic acid A from guaiac resin  
The invention provides a diagnostic agent for the detection of occult blood in feces comprising hydrogen peroxide and, as a chromogen, guaiaconic acid A, optionally with a stabilizer. The invention...
3511825 OXYALKYLATED WOOD TARS  
3265651 Polysulfide-neutralized pine tar compositions  
3251793 Coating compositions comprising ethylenically unsaturated compounds and pine wood resin  
Matches 1 - 33 out of 33