|
Match
|
Document |
Document Title |
|
|
7618941 |
Treating degenerative joint disorders with tribonectins
The invention features a tribonectin and a method of tribosupplementation carried out by administering tribonectins directly to an injured or arthritic joint.
|
|
|
7618648 |
Satiety inducing composition
The invention provides the use of a whey protein and/or whey protein hydrolysate which stimulate the cellular release of the satiety peptides choleocystokinin and glucagon-like-peptide in the...
|
|
|
7608284 |
Enamel matrix protein composition for treatment of systemic inflammatory response syndrome
The present invention relates to the use of a preparation of an active enamel matrix substance, such as an amelogenin, for the manufacture of a pharmaceutical composition for modulating an immune...
|
|
|
7608283 |
Coral purification method and coral thus obtained
The present invention provides a method of extracting organic substances present in coral, which consists in treating the coral with a fluid or a mixture of fluids in the supercritical state...
|
|
|
7601689 |
Angiogenin complexes (ANGex) and uses thereof
Stabilized angiogenin compositions and methods of preparing a stabilized angiogenin compositions by non-covalent immobilization on a naturally occurring substrate, such as a protein, lipid, nucleic...
|
|
|
7601515 |
Process of high purity albumin production
A process is provided for the preparation of albumin from a yeast culture medium which has extremely low levels of or is essentially free of colorants, metal ions, human proteins, host proteins,...
|
|
|
7585835 |
GASP1: a follistatin domain containing protein
The present invention relates to the use of a protein, GASP1, comprising at least one follistatin domain to modulate the level or activity of growth and differentiation factor-8 (GDF-8). More...
|
|
|
7582603 |
Method for treating or inhibiting intestinal inflammation
Peptide antagonists of zonulin are disclosed, as well as methods for the use of the same. The peptide antagonists bind to the zonula occludens receptor, yet do not physiologically modulate the...
|
|
|
7579316 |
Compositions and methods to modulate an immune response to an immunogenic therapeutic agent
Methods and compositions for modulating an immune response to an immunogenic therapeutic agent are disclosed. One of the disclosed methods comprises administering an effective amount of CTLA-4 to...
|
|
|
7579315 |
Casein peptides for alleviating or preventing aging of skin
Provided is use of a peptide, or a derivative of a peptide, in the manufacture of a medicament effective in alleviating or preventing periodontal disease, wherein the peptide comprises an amino...
|
|
|
7572763 |
Follistatin domain containing proteins
The present invention relates to the use of proteins comprising at least one follistatin domain to modulate the level or activity of growth and differentiation factor-8 (GDF-8). More particularly,...
|
|
|
7572465 |
Isolated material having an anti-organotrophic effect
A material having the ability to reduce organ mass has been isolated by collecting ovarian venous blood from a female mammal; preparing ovarian venous plasma from the blood; and at least partially...
|
|
|
RE40849 |
Method of treatment of glutathione deficient mammals
Glutathione (GSH) is a tripeptide of extreme importance as a catalyst, reductan, and reactant. It can be depleted intracellulary either by forming a direct complex with an electrophilic agent...
|
|
|
7544781 |
Polypeptide and process for producing the same
A process for producing a polypeptide, by reacting a peptide component (A) represented by formula (1) below with a peptide component (B) represented by formula (2) below and optionally a compound...
|
|
|
7531518 |
Method for fostering bone formation and preservation
A method of inducing bone formation in a subject in need of such inducement comprises the steps of mechanically inducing an increase in osteoblast activity in the subject and elevating blood...
|
|
|
7531509 |
Papillosin antimicrobial peptide, a gene coding said peptide, a vector, a transformed organism and a compound containing said organism
An antimicrobial peptide isolated from an extract from a marine invertebrate, whose amino acid sequence is as follows:
GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ (SEQ ID No. 1), its derivatives, its...
|
|
|
7531504 |
Pharmaceutical composition and method for inhibiting gastrointestinal inflammation
Peptide antagonists of zonulin are disclosed, as well as methods for the use of the same. The peptide antagonists bind to the zonula occludens receptor, yet do not physiologically modulate the...
|
|
|
7531502 |
Diagnostic conjugate useful for intracellular imaging and for differentiating between tumor- and non-tumor cells
Described is a diagnostic conjugate comprising (a) a transmembrane module (TPU), (b) an address module (AS), preferably an antisense peptide nucleic acid (PNA), and (c) a signaling module (SM). The...
|
|
|
7531501 |
Method of treating endothelial injury
The use of human erythropoietin (EPO) to prevent or treat endothelial injury due to chemotherapy, radiation therapy, mechanical trauma, or to a disease state which damages the endothelium (such as...
|
|
|
7521423 |
Exendin pharmaceutical compositions
Methods for reducing gastric motility and delaying gastric emptying for therapeutic and diagnostic purposes are disclosed which comprise administration of an effective amount of an exendin or an...
|
|
|
7517530 |
Methods for treatment of insulin-like growth factor-1 (IGF-1) deficiency comprising administration of IGF-1 and growth hormone
The present invention provides methods and compositions for increasing the growth rates, alleviating the symptoms, or improving the metabolism of human patients having insulin-like growth factor-1...
|
|
|
7504115 |
Shark cartilage extracts and use thereof for immunomodulation
Disclosed is a composition from shark cartilage comprising immunoactive proteoglycans and other immunoactive components having a molecular weight greater than about 100 KD, wherein the composition...
|
|
|
7476649 |
Antiproliferative and antiviral proteins and peptides
The present invention relates to peptides and proteins which may be used to inhibit infection or cell proliferation. It is based, at least in part, on the discovery of peptides and proteins...
|
|
|
7470660 |
Treatment for dark adaptation
The present invention addresses the treatment of age-related macular degeneration, and treatment of individuals with impaired visual function such as impaired dark adaptation, using regulation of...
|
|
|
7470659 |
Methods to increase reverse cholesterol transport in the retinal pigment epithelium (RPE) and Bruch's membrane (BM)
The present invention addresses the treatment of age-related macular degeneration using regulation of pathogenic mechanisms similar to atherosclerosis. In further specific embodiments, compositions...
|
|
|
7465711 |
Treatment of cancers of lymphocytic cells with product R
A method of treating a patient suffering from cancers of lymph cells such as acute lymphocytic leukemia, chronic lymphocytic leukemia, Hodgkin's disease and non-Hodgkin's lymphoma comprises...
|
|
|
7452867 |
Use of ADNF polypeptides for treating peripheral neurotoxicity
This invention relates to the use of ADNF polypeptides in the treatment of neurotoxicity induced by chemical agents or by disease processes. The ADNF polypeptides include ADNF I and ADNF III (also...
|
|
|
7449546 |
Method for extending storage of glutathione solutions and methods for treating Parkinson's disease with said stored glutathione solutions
A method of storing solutions of reduced glutathione for extended periods of time, by dissolving reduced glutathione in an aqueous medium having a pH of between 5.0 and 8.0 to produce a reduced...
|
|
|
7445764 |
Carrier-drug conjugate
The invention relates to a carrier-drug conjugate comprising a carrier containing a polypeptide sequence having one or several cysteine radicals and a pharmacon containing a pharmaceutical and/or...
|
|
|
7442308 |
Process for removing viruses in fibrinogen solutions and fibrinogen obtained by said process
A process for removing viruses in fibrinogen solutions and fibrinogen obtained thereof wherein the process starts with an adjusted purified fibrinogen solution, the adjusted purified solution is...
|
|
|
7439234 |
Method for treating cancer patients undergoing chemotherapy
A method for treating cancer patients undergoing chemotherapeutic treatments by administering Product R, a peptide-nucleic acid preparation, is disclosed.
|
|
|
7432241 |
Device for treating diabetes and methods thereof
A composite supported vascular graft comprising Vascular Endothelial Growth Factor (VEGF) and/or Platelet Derived Growth Factor (PDGF) for enhanced site-specific angiogenesis and methods thereof...
|
|
|
7429567 |
Sustained delivery of PDGF using self-assembling peptide nanofibers
The present invention is directed to a therapeutic composition in which human PDGF is bound directly to peptides that self assemble into a biologically compatible gel. When implanted in a patient's...
|
|
|
7425542 |
Stabilizing alkylglycoside compositions and methods thereof
The present invention relates to alkylglycoside-containing compositions and methods for increasing the stability, reducing the aggregation and immunogenicity, increasing the biological activity,...
|
|
|
7419683 |
Method of inhibiting side effects of pharmaceutical compositions containing amphiphilic vehicles or drug carrier molecules
A method is provided for inhibiting or preventing toxicity and other unwanted effects (a) caused by solvents for pharmaceuticals which solvents or emulsifier which contain amphiphilic molecules...
|
|
|
7417023 |
Targeted delivery of bioaffecting compounds for the treatment of cancer
A homogeneous conjugate for targeting and treating diseased cells wherein the conjugate comprises an anti-cancer drug and a targeting protein, wherein said anti-cancer drug is selected from the...
|
|
|
7407934 |
Methods for regulating postprandial blood glucose
Methods for treating conditions associated with elevated, inappropriate or undesired post-prandial blood glucose levels are disclosed which comprise administration of an effective amount of an...
|
|
|
7402655 |
Molecules designated LDCAM
The invention is directed to LDCAM as a purified and isolated protein, the DNA encoding the LDCAM, host cells transfected with cDNAs encoding LDCAM, processes for preparing LDCAM polypeptides and...
|
|
|
7393829 |
Pharmaceutical compositions comprising fragments and homologs of troponin subunits
The present invention relates to pharmaceutical compositions comprising therapeutically effective amounts of fragments or homologs of troponin C, I or T subunits for the treatment of diseases or...
|
|
|
7388124 |
Non-traumatic model for neurogenic pain
A method for producing a non-human mammalian model for neurogenic pain is provided, which includes altering a peripheral nerve of a non-human mammal by non-surgically placing a gel substance into...
|
|
|
7384918 |
Botulinum toxin for treating muscle contracture
The invention provides for the use of a botulinum toxin to treat contracture, such as muscle contracture, in patients by transdermal administration of the botulinum toxin.
|
|
|
7384916 |
Methods and compositions for preventing and treating aging or photodamaged skin
Disclosed are methods for treating aging and photodamaged skin employing topical application of compositions which comprise at least one peptide manganese complex. Also disclosed are methods...
|
|
|
7378389 |
Botulinum toxin neurotoxic component for treating juvenile cerebral palsy
The invention provides for the use of a presynaptic neurotoxin (for example a bacterial neurotoxin such as botulinum toxin A) for the manufacture of a medicament for the treatment of cerebral palsy...
|
|
|
7378096 |
Stress protein compositions and methods for prevention and treatment of cancer and infectious disease
Pharmaceutical compositions comprising a stress protein complex and related molecules encoding or cells presenting such a complex are provided. The stress protein complex comprises an hsp110 or...
|
|
|
7375080 |
Immobilized lactoferrin (Im-LF) antimicrobial agents and uses thereof
Disclosed is a composition of matter comprising a defined dispersion of lactoferria immobilized on a naturally occuring substrate via the N-terminus region of the lactoferrin. Compositions...
|
|
|
7371721 |
Use of GLP-2 and related compounds for the treatment, prevention, diagnosis, and prognosis of bone-related disorders and calcium homeostasis related syndromes
The present invention relates to methods for prevention and treatment of bone-related disorders and calcium homeostasis related syndromes using a GLP-2 molecule or GLP-2 activator either alone or...
|
|
|
7371411 |
Methods for production of the oxidized glutathione composite with CIS-diamminedichloroplatinum and pharmaceutical compositions based thereof regulating metabolism, proliferation, differentiation and apoptotic mechanisms for normal and transformed cells
The present invention relates to a composite for the treatment of a variety of medical conditions, the composite comprising an oxidized glutathione-based compound, which has a disulfide bond, and a...
|
|
|
7368425 |
Cyclic peptides for modulating growth of neo-vessels and their use in therapeutic angiogenesis
The present disclosure teaches analogs of human chemokines and methods of using them in the prevention, treatment, and ameliorization of diseases that can benefit from therapeutic angiogenesis. The...
|
|
|
7358284 |
Particulate acellular tissue matrix
A method of processing an acellular tissue matrix to give a particulate acellular tissue matrix includes: cutting sheets of dry acellular tissue matrix into strips; cryofracturing the dry acellular...
|
|
|
7354896 |
Administration of leptin
A method and composition for administering leptin to a subject. The invention includes suspending isolated native leptin-containing milk fat globules in a suitable medium for administering to a...
|