Match Document Document Title
7618941 Treating degenerative joint disorders with tribonectins  
The invention features a tribonectin and a method of tribosupplementation carried out by administering tribonectins directly to an injured or arthritic joint.
7618648 Satiety inducing composition  
The invention provides the use of a whey protein and/or whey protein hydrolysate which stimulate the cellular release of the satiety peptides choleocystokinin and glucagon-like-peptide in the...
7608284 Enamel matrix protein composition for treatment of systemic inflammatory response syndrome  
The present invention relates to the use of a preparation of an active enamel matrix substance, such as an amelogenin, for the manufacture of a pharmaceutical composition for modulating an immune...
7608283 Coral purification method and coral thus obtained  
The present invention provides a method of extracting organic substances present in coral, which consists in treating the coral with a fluid or a mixture of fluids in the supercritical state...
7601689 Angiogenin complexes (ANGex) and uses thereof  
Stabilized angiogenin compositions and methods of preparing a stabilized angiogenin compositions by non-covalent immobilization on a naturally occurring substrate, such as a protein, lipid, nucleic...
7601515 Process of high purity albumin production  
A process is provided for the preparation of albumin from a yeast culture medium which has extremely low levels of or is essentially free of colorants, metal ions, human proteins, host proteins,...
7585835 GASP1: a follistatin domain containing protein  
The present invention relates to the use of a protein, GASP1, comprising at least one follistatin domain to modulate the level or activity of growth and differentiation factor-8 (GDF-8). More...
7582603 Method for treating or inhibiting intestinal inflammation  
Peptide antagonists of zonulin are disclosed, as well as methods for the use of the same. The peptide antagonists bind to the zonula occludens receptor, yet do not physiologically modulate the...
7579316 Compositions and methods to modulate an immune response to an immunogenic therapeutic agent  
Methods and compositions for modulating an immune response to an immunogenic therapeutic agent are disclosed. One of the disclosed methods comprises administering an effective amount of CTLA-4 to...
7579315 Casein peptides for alleviating or preventing aging of skin  
Provided is use of a peptide, or a derivative of a peptide, in the manufacture of a medicament effective in alleviating or preventing periodontal disease, wherein the peptide comprises an amino...
7572763 Follistatin domain containing proteins  
The present invention relates to the use of proteins comprising at least one follistatin domain to modulate the level or activity of growth and differentiation factor-8 (GDF-8). More particularly,...
7572465 Isolated material having an anti-organotrophic effect  
A material having the ability to reduce organ mass has been isolated by collecting ovarian venous blood from a female mammal; preparing ovarian venous plasma from the blood; and at least partially...
RE40849 Method of treatment of glutathione deficient mammals  
Glutathione (GSH) is a tripeptide of extreme importance as a catalyst, reductan, and reactant. It can be depleted intracellulary either by forming a direct complex with an electrophilic agent...
7544781 Polypeptide and process for producing the same  
A process for producing a polypeptide, by reacting a peptide component (A) represented by formula (1) below with a peptide component (B) represented by formula (2) below and optionally a compound...
7531518 Method for fostering bone formation and preservation  
A method of inducing bone formation in a subject in need of such inducement comprises the steps of mechanically inducing an increase in osteoblast activity in the subject and elevating blood...
7531509 Papillosin antimicrobial peptide, a gene coding said peptide, a vector, a transformed organism and a compound containing said organism  
An antimicrobial peptide isolated from an extract from a marine invertebrate, whose amino acid sequence is as follows: GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ (SEQ ID No. 1), its derivatives, its...
7531504 Pharmaceutical composition and method for inhibiting gastrointestinal inflammation  
Peptide antagonists of zonulin are disclosed, as well as methods for the use of the same. The peptide antagonists bind to the zonula occludens receptor, yet do not physiologically modulate the...
7531502 Diagnostic conjugate useful for intracellular imaging and for differentiating between tumor- and non-tumor cells  
Described is a diagnostic conjugate comprising (a) a transmembrane module (TPU), (b) an address module (AS), preferably an antisense peptide nucleic acid (PNA), and (c) a signaling module (SM). The...
7531501 Method of treating endothelial injury  
The use of human erythropoietin (EPO) to prevent or treat endothelial injury due to chemotherapy, radiation therapy, mechanical trauma, or to a disease state which damages the endothelium (such as...
7521423 Exendin pharmaceutical compositions  
Methods for reducing gastric motility and delaying gastric emptying for therapeutic and diagnostic purposes are disclosed which comprise administration of an effective amount of an exendin or an...
7517530 Methods for treatment of insulin-like growth factor-1 (IGF-1) deficiency comprising administration of IGF-1 and growth hormone  
The present invention provides methods and compositions for increasing the growth rates, alleviating the symptoms, or improving the metabolism of human patients having insulin-like growth factor-1...
7504115 Shark cartilage extracts and use thereof for immunomodulation  
Disclosed is a composition from shark cartilage comprising immunoactive proteoglycans and other immunoactive components having a molecular weight greater than about 100 KD, wherein the composition...
7476649 Antiproliferative and antiviral proteins and peptides  
The present invention relates to peptides and proteins which may be used to inhibit infection or cell proliferation. It is based, at least in part, on the discovery of peptides and proteins...
7470660 Treatment for dark adaptation  
The present invention addresses the treatment of age-related macular degeneration, and treatment of individuals with impaired visual function such as impaired dark adaptation, using regulation of...
7470659 Methods to increase reverse cholesterol transport in the retinal pigment epithelium (RPE) and Bruch's membrane (BM)  
The present invention addresses the treatment of age-related macular degeneration using regulation of pathogenic mechanisms similar to atherosclerosis. In further specific embodiments, compositions...
7465711 Treatment of cancers of lymphocytic cells with product R  
A method of treating a patient suffering from cancers of lymph cells such as acute lymphocytic leukemia, chronic lymphocytic leukemia, Hodgkin's disease and non-Hodgkin's lymphoma comprises...
7452867 Use of ADNF polypeptides for treating peripheral neurotoxicity  
This invention relates to the use of ADNF polypeptides in the treatment of neurotoxicity induced by chemical agents or by disease processes. The ADNF polypeptides include ADNF I and ADNF III (also...
7449546 Method for extending storage of glutathione solutions and methods for treating Parkinson's disease with said stored glutathione solutions  
A method of storing solutions of reduced glutathione for extended periods of time, by dissolving reduced glutathione in an aqueous medium having a pH of between 5.0 and 8.0 to produce a reduced...
7445764 Carrier-drug conjugate  
The invention relates to a carrier-drug conjugate comprising a carrier containing a polypeptide sequence having one or several cysteine radicals and a pharmacon containing a pharmaceutical and/or...
7442308 Process for removing viruses in fibrinogen solutions and fibrinogen obtained by said process  
A process for removing viruses in fibrinogen solutions and fibrinogen obtained thereof wherein the process starts with an adjusted purified fibrinogen solution, the adjusted purified solution is...
7439234 Method for treating cancer patients undergoing chemotherapy  
A method for treating cancer patients undergoing chemotherapeutic treatments by administering Product R, a peptide-nucleic acid preparation, is disclosed.
7432241 Device for treating diabetes and methods thereof  
A composite supported vascular graft comprising Vascular Endothelial Growth Factor (VEGF) and/or Platelet Derived Growth Factor (PDGF) for enhanced site-specific angiogenesis and methods thereof...
7429567 Sustained delivery of PDGF using self-assembling peptide nanofibers  
The present invention is directed to a therapeutic composition in which human PDGF is bound directly to peptides that self assemble into a biologically compatible gel. When implanted in a patient's...
7425542 Stabilizing alkylglycoside compositions and methods thereof  
The present invention relates to alkylglycoside-containing compositions and methods for increasing the stability, reducing the aggregation and immunogenicity, increasing the biological activity,...
7419683 Method of inhibiting side effects of pharmaceutical compositions containing amphiphilic vehicles or drug carrier molecules  
A method is provided for inhibiting or preventing toxicity and other unwanted effects (a) caused by solvents for pharmaceuticals which solvents or emulsifier which contain amphiphilic molecules...
7417023 Targeted delivery of bioaffecting compounds for the treatment of cancer  
A homogeneous conjugate for targeting and treating diseased cells wherein the conjugate comprises an anti-cancer drug and a targeting protein, wherein said anti-cancer drug is selected from the...
7407934 Methods for regulating postprandial blood glucose  
Methods for treating conditions associated with elevated, inappropriate or undesired post-prandial blood glucose levels are disclosed which comprise administration of an effective amount of an...
7402655 Molecules designated LDCAM  
The invention is directed to LDCAM as a purified and isolated protein, the DNA encoding the LDCAM, host cells transfected with cDNAs encoding LDCAM, processes for preparing LDCAM polypeptides and...
7393829 Pharmaceutical compositions comprising fragments and homologs of troponin subunits  
The present invention relates to pharmaceutical compositions comprising therapeutically effective amounts of fragments or homologs of troponin C, I or T subunits for the treatment of diseases or...
7388124 Non-traumatic model for neurogenic pain  
A method for producing a non-human mammalian model for neurogenic pain is provided, which includes altering a peripheral nerve of a non-human mammal by non-surgically placing a gel substance into...
7384918 Botulinum toxin for treating muscle contracture  
The invention provides for the use of a botulinum toxin to treat contracture, such as muscle contracture, in patients by transdermal administration of the botulinum toxin.
7384916 Methods and compositions for preventing and treating aging or photodamaged skin  
Disclosed are methods for treating aging and photodamaged skin employing topical application of compositions which comprise at least one peptide manganese complex. Also disclosed are methods...
7378389 Botulinum toxin neurotoxic component for treating juvenile cerebral palsy  
The invention provides for the use of a presynaptic neurotoxin (for example a bacterial neurotoxin such as botulinum toxin A) for the manufacture of a medicament for the treatment of cerebral palsy...
7378096 Stress protein compositions and methods for prevention and treatment of cancer and infectious disease  
Pharmaceutical compositions comprising a stress protein complex and related molecules encoding or cells presenting such a complex are provided. The stress protein complex comprises an hsp110 or...
7375080 Immobilized lactoferrin (Im-LF) antimicrobial agents and uses thereof  
Disclosed is a composition of matter comprising a defined dispersion of lactoferria immobilized on a naturally occuring substrate via the N-terminus region of the lactoferrin. Compositions...
7371721 Use of GLP-2 and related compounds for the treatment, prevention, diagnosis, and prognosis of bone-related disorders and calcium homeostasis related syndromes  
The present invention relates to methods for prevention and treatment of bone-related disorders and calcium homeostasis related syndromes using a GLP-2 molecule or GLP-2 activator either alone or...
7371411 Methods for production of the oxidized glutathione composite with CIS-diamminedichloroplatinum and pharmaceutical compositions based thereof regulating metabolism, proliferation, differentiation and apoptotic mechanisms for normal and transformed cells  
The present invention relates to a composite for the treatment of a variety of medical conditions, the composite comprising an oxidized glutathione-based compound, which has a disulfide bond, and a...
7368425 Cyclic peptides for modulating growth of neo-vessels and their use in therapeutic angiogenesis  
The present disclosure teaches analogs of human chemokines and methods of using them in the prevention, treatment, and ameliorization of diseases that can benefit from therapeutic angiogenesis. The...
7358284 Particulate acellular tissue matrix  
A method of processing an acellular tissue matrix to give a particulate acellular tissue matrix includes: cutting sheets of dry acellular tissue matrix into strips; cryofracturing the dry acellular...
7354896 Administration of leptin  
A method and composition for administering leptin to a subject. The invention includes suspending isolated native leptin-containing milk fat globules in a suitable medium for administering to a...