|
Match
|
Document |
Document Title |
|
|
6838433 |
IL-6 antagonist peptides
The present invention relates to IL-6 antagonist peptides, isolatable from a peptide library through the two-hybrids system by their ability to bind to the intracellular domain of gp130 and...
|
|
|
6835382 |
Ii peptide therapeutics to enhance antigen presentation
Disclosed is a class of compounds referred to herein as effector compounds. Effector compounds are useful in connection with the modulation of an immune response. Modulation refers to the ability...
|
|
|
6828304 |
Peptides for treatment of cancer
This invention relates to novel antiproliferative and anti secrectory peptides that are inhibitory to vasoactive intestinal peptide receptor and are useful in the treatment of cancer. The invention...
|
|
|
6827937 |
HBV capsid-binding peptide immunogens
This invention relates to hepatitis B virus (“HBV”) core antigen particles that are characterized by multiple immunogen specificities. More particularly, the invention relates to HBV core...
|
|
|
6821948 |
Conjugate for mediating cell, compartment or membrane-specific transport of active substances
The present invention relates to conjugates for mediating a cell-specific, compartment-specific or membrane-specific to methods of active substances. The invention also relates to methods of...
|
|
|
6821950 |
Cyclic agonists and antagonists of C5a receptors and G protein-coupled receptors
The present invention relates to novel cyclic or constrained acyclic compounds which modulate the activity of G protein-coupled receptors and are useful in the treatment of conditions mediated by G...
|
|
|
6821954 |
Compounds and uses thereof in treating bone disorders
A compound derived from amylin is disclosed. Pharmaceutical compositions contain such compounds and are used in the treatment of bone disorders where stimulation of bone growth is required.
|
|
|
6818617 |
EC-3, an inhibitor of α4β1 and α4β7 integrins
This invention relates to the identification, purification, and characterization of a novel heterodimeric disintegrin, EC-3, from Echis carinatus viper venom. EC-3 inhibits α4 integrins in an...
|
|
|
6811996 |
DDS compounds and method for assaying the same
A drug delivery system compound comprising a carboxy(C 1-4 )alkyldextran polyalcohol modified with a saccharide compound and a residue of drug compound bound to the carboxy(C 1-4 )alkyldextran...
|
|
|
6806255 |
Compounds and methods for modulating adhesion molecule function
Modulating agents and methods for enhancing or inhibiting cadherin-mediated functions are provided. The modulating agents comprise at least an HAV binding motif, an analogue or peptidomimetic...
|
|
|
6794362 |
Asparagine containing elastin peptide analogs
The present invention is directed to a composition which is used to enhance the elasticity and/or appearance of tissue. Specifically, the present invention is directed to a composition formulated...
|
|
|
6787520 |
Inactivating process for lipid envelopped virus, and new antivirus lipopeptides
The invention relates to an extraordinarily efficient method of inactivating lipid-enveloped viruses, such as herpes or retroviruses, in biological or biotechnological—particularly...
|
|
|
6784155 |
Inhibitor and stimulator of stem cell proliferation and uses thereof
Disclosed and claimed are methods for the isolation and use of stem cell modulating factors for regulating stem cell cycle and for accelerating the post-chemotherapy peripheral blood cell recovery....
|
|
|
6777389 |
Cosmetic or dermatological use of 7-hydroxylated steroids in combination with elastin derived peptides
The present invention is directed to a composition and method for enhancing the appearance of skin or tissue. The invention is preferably a combination of elastin-derived peptides and steroidal...
|
|
|
6774109 |
Inhibition of amylin release
A method of determining the ability of a compound to both bind to somatostatin type-5 receptor (“SSTR-5”) and inhibit amylin release. The method includes obtaining a preparation, either a cell...
|
|
|
6770626 |
Tissue remodeling
The invention concerns a method for the modulation of tissue-remodeling processes, by contacting the tissue to be remodeled with a compound comprising a sequence derived from certain regions of...
|
|
|
6734166 |
Method of reducing aluminum levels in the central nervous system
A method of reducing aluminum concentrations in the central nervous system of a subject (e.g., a patient afflicted with Alzheimer's disease or at risk of developing Alzheimer's disease) comprises...
|
|
|
6730660 |
Peritoneal dialysis solutions with polypeptides
The present invention provides an improved dialysis solution. The improved dialysis solution provides for the use of specific polypeptides as an osmotic agent with an additional osmotic agent such...
|
|
|
6716809 |
Mage-A3 peptides presented by HLA class molecules
The invention describes HLA class II binding peptides encoded by the MAGE-A3 tumor associated gene, as well as nucleic acids encoding such peptides and antibodies relating thereto. The peptides...
|
|
|
6699838 |
Antiangiogenic peptides
Mammalian kringle 5 fragments and kringle 5 fusion proteins are disclosed as a compounds for treating angiogenic diseases. Methods and compositions for inhibiting angiogenic diseases are also...
|
|
|
6699833 |
Pharmaceutical formulations for sustained drug delivery
Sustained delivery formulations comprising a water-insoluble complex of a peptide and a carrier macromolecule are disclosed. The formulations of the invention allow for loading of high...
|
|
|
6696274 |
Ligand for enhancing oral and CNS delivery of biological agents
Provided herein is a novel and useful Ligand comprising a peptide comprising an amino acid sequence of SEQ. ID. NO.:6, an analog, a derivative, or a variant thereof, which increases the absorption...
|
|
|
6693082 |
Method of inhibiting metastatic dissemination using desmopressin
The present invention relates to the use of 1-deamino-8-D-arginine vasopressin (desmopressin), or a pharmaceutically acceptable salt thereof or a pharmaceutical composition containing any of them,...
|
|
|
6686334 |
Use of inhibitors of protein kinase C epsilon to treat pain
The role of the ε isozyme of protein kinase C (“PKCε”) in pain perception, particularly hyperalgesia, methods of lessening pain through administration of inhibitors of PKCε, methods of...
|
|
|
6682740 |
Peptides derived fram complement peptide C3a sequence and antiallergic compositions comprising them
Peptides corresponding partially or entirely to positions 50-77 of the sequence of the complement-derived peptide C3 a and analogs thereof are capable of inhibiting IgE-mediated triggering and/or...
|
|
|
6683048 |
Compounds and methods for stimulating gene expression and cellular differentiation
Modulating agents for inhibiting an interaction between α-catenin and β-catenin are provided. The modulating agents comprise one or more of: (a) a β-catenin HAV motif; (b) a peptide analogue or...
|
|
|
6673839 |
Pharmaceutical compositions with antitumour activity
Acylcarnitines, such as L-acetylcarnitine (I) were found to have marked antitumour activity, which can be further increased by simultaneous administration of somatosstatin.
|
|
|
6673769 |
Lanthionine bridged peptides
Disclosed are lanthionine bridged peptides having the structure methods of their preparation and their use as pharmacologically active agents.
|
|
|
6664228 |
Photoselective marking of biological targets
A drug delivery system and methods are provided wherein a therapeutic/diagnostic agent or a component of the immune system is directed to particular cells in a selected organ or a specific site....
|
|
|
6664232 |
HLA-A2 restraint tumor antigen peptide originating in SART-1
An HLA-A2 restricted tumor antigen peptide originated fromr SART-1, derivatives thereof having characteristics functionally equivalent thereto; therapeutic, prophylactic or diagnostic agents for...
|
|
|
6645934 |
Peptide with radio protective effect
The invention makes available a peptide having a radioprotective effect that comprises a modified form and/or an optionally modified fragment of the Bowman-Birk protease inhibitor (BBI).
|
|
|
6638912 |
Peptide compositions mimicking TGF-β activity
Compositions suitable for pharmaceutical administration are provided in which one compound is a small peptide mimic of TGF-β. More preferably, pharmaceutical compositions of the present invention...
|
|
|
6638905 |
Cloning and recombinant production of CFR receptor(s)
In accordance with the present invention, there are provided novel G-protein-coupled receptor proteins (CRF-R) characterized by having sufficient binding affinity for corticotropin releasing factor...
|
|
|
6632795 |
Dolastatin-15 derivatives in combination with taxanes
The present invention provides compositions and methods for the treatment of cancer in a subject wherein compounds of Formula I as defined herein in combination with paclitaxel, taxotere or...
|
|
|
6627610 |
Method for inhibition of viral morphogenesis
Viral morphogenesis, production, release or uncoating can be inhibited by effecting inhibition of prenylation of, or inhibition of post-prenylation reactions of, at least one viral protein. The use...
|
|
|
6627604 |
Memno peptides, process for their preparation and use thereof
The invention relates to novel peptide derivatives, called memno peptides, of the formula (I): wherein R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 and (A)n have the meaning herein, obtainable...
|
|
|
6623740 |
Structurally modified peptides that are resistant to peptidase degradation
Human melanoma cells bear antigens that are recognized by autologous CD8 + cytotoxic T-lymphocytes. The invention involves the reception of particular peptides analogues of the MZ2-E antigen by...
|
|
|
6623732 |
Pharmaceutical formulation for nasal administration
This invention discloses a pharmaceutical formulation for nasal administration which contains a pharmaceutically active polypeptide and a method producing the pharmaceutical formulation. The...
|
|
|
6610649 |
Insulin C-peptides
The invention features peptides that are fragments of the human insulin C-peptide, which peptides include the sequence ELGGGPGAG or a fragment thereof, or the sequence EGSLQ or a fragment thereof....
|
|
|
6610658 |
Modulators of &mgr -amyloid peptide aggregation
Compounds that modulate natural β amyloid peptide aggregation are provided. The modulators of the invention comprise a peptide, preferably based on a β amyloid peptide, that is comprised entirely...
|
|
|
6608025 |
Human NESP55 polypeptides, polynucleotides and uses thereof
A substantially pure polypeptide (human NESP55) comprising the amino acid sequence (SEQ ID NO: 2) IRLEVPKRMDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALL ...
|
|
|
6602852 |
Basic peptides and pharmaceutical compositions containing same
The present invention relates to an NST300 compound of general formula (I): comprising the following components: X1—[(X3)a/(X4)b] in which X1 represents a fatty acid or prenyl group; and X3...
|
|
|
6596692 |
Substance P analogs for the treatment of cancer
The present invention encompasses novel synthetic peptide analogs that are antagonists to Substance P, substance P like peptides and related peptides and are useful for the treatment of cancer. The...
|
|
|
6593297 |
Compounds and methods for inhibiting cancer metastasis
Agents for inhibiting cancer metastasis are provided. The methods comprise administering to a patient an antimetastatic agent that comprises one or more of: (a) a peptide sequence that is at least...
|
|
|
6586402 |
LH-RH peptide analogues, their uses and pharmaceutical compositions containing them
The invention relates to LH-RH peptide analogues with excellent affinity for LH-RH receptors, of the formula: A1-A2-A3-A4-A5-A6-HAA-A7-Pro-Z (I) The invention also relates to the uses of said...
|
|
|
6579848 |
Depigmenting activity of agouti signal protein and peptides thereof
The invention is an agouti signaling protein and peptides as well as pharmaceutical compositions thereof and their use in methods of inhibiting melanin production by melanocytes. The agouti...
|
|
|
6576611 |
Methods of reducing atrophy or dysfunction of gut-associated lymphoid tissue
The present invention describes methods for reducing the impairment respiratory tract mucosal immunity associated with a lack of enteral feeding or a lack of immunological stimulation of the...
|
|
|
6573236 |
Inhibiting MOG-antibody binding
The invention provides methods and compositions for inhibiting pathogenic binding of an pathogenic autoantibody to a myelin oligodendrocyte glycoprotein (MOG) autoantigen and screening for...
|
|
|
6569833 |
Cyclin dependent kinase binding peptides
The present disclosure identifies substances having the property of binding to cyclin dependent kinase (cdk) comprising: (i) a peptide including amino acid residue 84 to 103 of full length p16...
|
|
|
6566335 |
Methods for mobilizing hematopoietic progenitor cells from bone marrow into peripheral blood in a patient in need of chemotherapy
The present invention provides improved methods, kits, and pharmaceutical compositions for increasing white blood cell survival following chemotherapy, and mobilizing hematopoietic progenitor cells...
|