|
Match
|
Document |
Document Title |
|
|
8071093 |
Fully human anti-epidermal growth factor receptor antibodies
Disclosed are fully human anti-epidermal growth factor receptor (EGFR) antibodies, fragments thereof, and nucleic acid sequences encoding for the same. Further disclosed are methods of making and...
|
|
|
7893205 |
Hemopoietin receptor protein, NR12
A novel hemopoietin receptor gene (NR12) was successfully isolated by extracting motifs conserved among the amino acid sequences of known hemopoietin receptors and by using the predicted sequence....
|
|
|
7887815 |
Peptide diagnostic agent for lyme disease
The present invention relates, e.g., to an isolated peptide consisting of the sequence MKKDDQIAAAIALRGMA (SEQ ID NO:1) or an active variant thereof, wherein the peptide or active variant can bind...
|
|
|
7666614 |
Method of use of one step immunochromatographic device for Streptococcus A antigen
A method to determine the presence or absence of Streptococcus Group A antigen in a sample, comprising the following steps: extracting the antigen from the sample in an assay chamber with two or...
|
|
|
7566540 |
Monoclonal antibody which agglutinates E. coli having the CS4-CFA/I family protein
A monoclonal antibody to a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA.(SEQ ID NO:1) The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS...
|
|
|
7553674 |
Methods of identifying compounds useful for modulating intraflagellar transport
The invention relates to various intraflagellar transport (IFT) polypeptides and the nucleic acids that encode them. The new IFT particle polypeptides and nucleic acids can be used in a variety of...
|
|
|
7462459 |
LAT1 transporters expressed in blood brain barrier cells
LAT1 is consistently expressed at high levels in brain microvessel endothelial cells. Disclosed herein are assays for determining whether a test material/molecule is a substrate for, and/or is...
|
|
|
7452680 |
MCT1 transporters expressed in blood brain barrier cells
MCT1 is consistently expressed at high levels in brain microvessel endothelial cells. Disclosed herein are assays for determining whether a test material/molecule is a substrate for, and/or is...
|
|
|
7238493 |
Acetylation of pRb by p300 assay method for compounds which modulate this process
The present invention is based upon the finding that the protein p300 has acetylation activity which is directed to the retinoblastoma tumour suppressor protein pRb by the presence in the cell of...
|
|
|
7223534 |
Diffraction-based diagnostic devices
A biosensor includes a substrate with a layer of receptive material disposed thereon. The receptive material is specific for an analyte of interest. A pattern of active and deactivated areas of the...
|
|
|
7169550 |
Diffraction-based diagnostic devices
A biosensor includes a substrate with a receptive material layer of radiation-absorbing member (RAM)-tagged biomolecules disposed thereon. The receptive material is specific for an analyte of...
|
|
|
7138240 |
Methods of assaying receptor activity
Described are methods of detecting G-protein coupled receptor (GPCR) activity in vivo and in vitro; methods of assaying GPCR activity; and methods of screening for GPCR ligands, G Protein-coupled...
|
|
|
7097973 |
Method for monitoring molecular species within a medium
Apparatus and methods for monitoring, analyzing, and/or discriminating molecular species, preferably a biomolecule, within a medium using a multisensor array (MSA) and multivariate processing....
|
|
|
6936423 |
Anti-LTNF for in vitro assay of biological toxins
Lethal Toxin Neutralizing Factor has been isolated in purity from opossum serum by high pressure liquid chromatography (HPLC) fractionation. The amino acid sequence from the N-terminal for the...
|
|
|
6916608 |
Composition for providing long term stability to cells for diagnostic testing
The present invention relates to a method and composition for stabilizing clinical specimens (i.e., cells in biological samples) for transport and subsequent testing for diagnosis. The composition...
|
|
|
6843991 |
Use of the M3 protein of MHV68 to block binding of a chemokine to its receptor
A pharmaceutical composition comprises M3 protein as encoded by virus MHV 68, or a homologue of said M3 protein, for use in binding to a chemokine or a chemokine analogue in vivo, or to block...
|
|
|
6696065 |
Acellular pertussis vaccines and methods of preparation thereof
A multi-component vaccine composition is described comprising acellular pertussis vaccine components, diphtheria toxoid, tetanus toxoid and inactivated poliovirus. The composition also may contain...
|
|
|
6689572 |
E. coli agglutination assay
A method for detecting Escherichia coli in a sample by providing a sample suspected of containing Escherichia coli; contacting the sample with beads coated with a mixture of antibodies or...
|
|
|
6676941 |
Antibody conjugate formulations for selectively inhibiting VEGF
Disclosed are antibodies that specifically inhibit VEGF binding to only one (VEGFR2) of the two VEGF receptors. The antibodies effectively inhibit angiogenesis and induce tumor regression, and yet...
|
|
|
6638725 |
Method for assaying receptor binding property and reagent for the assay
The present invention provides a method capable of simultaneous processing of plural test samples for the receptor binding property of a chemical substance, which does not require immobilization of...
|
|
|
6610495 |
Method for detecting proteinaceous inhibitors of protein-protein or DNA-protein interactions
The present invention relates generally to a method of identifying modulators of biological interactions and agents useful for same. More particularly, the present invention contemplates a method...
|
|
|
6562349 |
Otitis media vaccine
It has been discovered that a vaccine comprised of fimbrin, a filamentous protein derived from the bacterial surface appendages of non-typable Haemophilus influenzae is useful in studying,...
|
|
|
6365368 |
Rapid method for the detection and quantification of microbes in water
The present invention concerns methods of testing water for microbe contamination. The methods of the invention comprise supplementing existing methods with assays using specific reagents such as...
|
|
|
6290959 |
Method for screening compounds for inhibiting bacterial attachment to host cell receptors
Uroplakins Ia and Ib are the major urothelial receptors of type 1 fimbriated microorganisms. These uroplakins are used to screen compounds for treating urinary tract infections by testing if the...
|
|
|
6238874 |
Cell motility assay
An apparatus and method of use for assaying cellular motility in response to a concentration gradient of a chemotactic agent. Generally, the apparatus includes a chamber having a region for...
|
|
|
6168921 |
Method for the quantitative and/or qualitative determination of atoms or molecules
Receptor molecules are anchored on a solid or fluid flat substrate, these being able to selectively bind other atoms or molecules. The substrate surface is then ellipsometrically measured in that...
|
|
|
6100026 |
Matrices with memories and uses thereof
Combinations, called matrices with memories, of matrix materials that are encoded with an optically readable code are provided. The matrix materials are those that are used in as supports in solid...
|
|
|
6080539 |
In situ immunodetection of antigens
An antibody targeted to an antigen is brought into contact with a body component in situ. The resulting antibody/antigen complex is labeled and may be amplified. The label is then detected either...
|
|
|
6060326 |
Method to detect canine IgE and kit therefor
The present invention includes a method to detect canine IgE using a canine Fc epsilon receptor (Fcε R) to detect canine IgE antibodies in a biological sample from a canid. The present invention ...
|
|
|
6004766 |
Method for detecting low levels of microorganisms
A method is provided for the detection of low levels of a microorganism in a sample in the presence of competing microflora, comprising the steps of: (a) exposing the sample to a solid support to...
|
|
|
5932220 |
Diagnostic tests for a new spirochete, Borrelia lonestari sp. nov.
Bites from Amblyomma americanum, a hard tick, have been associated with a Lyme disease-like illness in the southeastern and south-central United States. Present in 2% of ticks collected in four...
|
|
|
5888748 |
Methods and articles of manufacture for the detection of cryptosporidium occysts
Embodiments of the present invention relate to methods and articles of manufacture for the detection of Giardia cysts and Crytosporidium oocysts.
|
|
|
5834591 |
Polypeptides and antibodies useful for the diagnosis and treatment of pathogenic neisseria and other microorganisms having type 4 pilin
The present invention provides a novel protein of pathogenic forms of Neisseria, as well as genes which encode PilC, i.e., the pilC loci. DNA sequences of pilC genes are useful as probes to...
|
|
|
5750344 |
Method for selection of biologically active peptide sequences
An improved method for determining binding compounds from a mixture of similar compounds, particularly a phage peptide library, is provided. The method comprises contacting a mixture of candidate...
|
|
|
5618533 |
Flagellin-based polypeptides for the diagnosis of lyme disease
Diagnostic means and methods for Lyme disease comprising B. burgdorferi flagellin polypeptides and antibodies. Compositions and methods comprising neuroborreliosis-associated antigens useful for...
|
|
|
5552272 |
Detection of an analyte by fluorescence using a thin film optical device
Device for detecting the presence or amount of an analyte of interest, comprising a reflective solid, optical support and a label capable of generating fluorescent signal upon excitation with a...
|
|
|
5510241 |
Method of testing for the presence of Salmonella serotypes expressing Salmonella enteritidis fimbrial antigen (SEFA) and reagents therefore
A method of testing for the presence of Salmonella serotypes S. enteritidis and S. dublin is provided. Novel monoclonal antibodies are used to detect the presence of an epitope specific for these...
|
|
|
5496700 |
Optical immunoassay for microbial analytes using non-specific dyes
The presently disclosed invention relates to a method of rapid detection and identification of microorganisms including bacteria, viruses, rickettsiae and fungi. The method involves staining all...
|
|
|
5489676 |
Polypeptides that potentiate bactericidal/permeability-increasing protein and methods for treating bacterial infections
Disclosed herein are purified isolated mammals polypeptides having the property of potentiating the bacterial growth inhibitory activity of bactericidal/permeability-increasing protein and...
|
|
|
5464741 |
Palladium (II) octaethylporphine alpha-isothiocyanate as a phosphorescent label for immunoassays
A phosphorescence assay system. The phosphorescent label for immunoassays is palladium (II) octaethylporphine alphaisothiocyanate. The labeling agent has a Stokes shift of not less than 150...
|
|
|
5459041 |
Campylobacter pylori antigens and uses thereof for detection of Campylobacter pylori infection
Antigenic compositions are disclosed for use in diagnostic kits and the like for detecting the presence of antibodies specific for Campylobacter pylori, bacteria often associated with the...
|
|
|
5354654 |
Lyophilized ligand-receptor complexes for assays and sensors
A dry reagent prepared by lyophilizing a labelled ligand-immobilized receptor complex or a labelled receptor-immobilized ligand complex is, on rehydration, useful for detecting analytes in samples...
|
|
|
5294544 |
Biologically active factor
The invention comprises a factor having the following characteristics: a) It inhibits granulocyte-macrophage colony and cluster formation; b) It has a molecular weight of about 8 kDa as determined...
|
|
|
5194382 |
Method for increasing the enzymatic reactivity of β-galactosidase by addition of a cyanate, thiocyanate, azide, or thiosulfate compound
In order to increase the enzymatic reactivity of β-galactosidase, an azide, thiocyanate, cyanate and/or thiosulphate is added to the reaction mixture.
|
|
|
4834976 |
Monoclonal antibodies to pseudomonas aeruginosa flagella
Cell lines have been produced that secrete monoclonal antibodies capable of binding to the flagellar proteins of selected Pseudomonas aeruginosa strains. Some of these antibodies have been found to...
|
|
|
4772464 |
Protective antibodies to serotypic determinants of flagellar antigens
Monoclonal antibodies specific to serotypic determinants on the flagella of a microorganism and found to be useful in inhibiting motility.
|
|
|
4769240 |
Pili of neisseria and vaccine compositions containing same
It has been found that immunologically related piliated organisms exhibit a hierarchic relationship wherein the cross-reactivity of the antisera to first pili against second pill in the series is...
|
|
|
4696896 |
Gonococcal Pili processes for the preparation thereof and the use thereof for the detection of and prevention of infections caused by Neisseria gonorrhoeae
There are provided a crystalline and single rod products derivable from the Pili of Type 1 and Type 2 Neisseria gonorrhoese organisms. There are provided methods of growing said organisms to...
|
|
|
3951748 |
Sensitized matrix for detection of disease
A specific sensitized matrix for diagnosing both infectious and non-infectious disease is disclosed comprised of an insoluble, inert, pliable and wettable matrix having a network of pores, and a...
|