Matches 1 - 50 out of 147 1 2 3 >
Match Document Document Title
7608247 Use of outer membrane protein a in treatment/prevention/diagnosis of bacterial infection in central nervous system and/or peripheral blood circulation  
The present invention provides a method for the treatment and/or prevention of bacterial infection in central nervous system and/or peripheral blood circulation in a mammal by administering...
7604811 Oral-intestinal vaccines against diseases caused by enteropathic organisms using antigens encapsulated within biodegradable-biocompatible microspheres  
This invention is directed to oral-intestinal vaccines and their use against diseases caused by enteropathogenic organisms using antigens encapsulated within biodegradable-biocompatible microspheres.
7575754 Avian E. coli vaccine for protection against colibacillosis  
A genetic deletion mutant live E. coli vaccine suitable for mass application to poultry, including chickens, is provided. Also provided is a safe and effective method to protect poultry against...
7527802 Vaccine for transcutaneous immunization  
A vaccine delivered by transcutaneous immunization provides an effective treatment against infections by pathogens such as, for example, enterotoxigenic Escherichia coli (ETEC) and/or for...
7455843 Adjuvant activities of mutants of LT-IIa and LT-IIb enterotoxin lacking binding to ganglioside  
The present invention describes the adjuvant activity of mutants of LT-IIa and LT-IIb enterotoxin which lack ganglioside binding activity. The adjuvant activity of the LT-IIb(T13I) mutant is...
7422752 Mutant forms of EtxB and CtxB and their use as carriers  
The present invention describes the use of a mutant form of EtxB or CtxB to deliver an agent to a target cell wherein the mutant has GM-1 binding activity; but wherein the mutant has a reduced...
7404961 Peptides responsive to antibodies against consensus peptide of the CS4-CFA/I family proteins  
This invention relates to amino acid sequences from within a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID. NO: 1) Eight mer peptides from within the...
7399474 Isolation and characterization of the csa operon (ETEC-CS4 pili) and methods of using same  
Compositions comprising products of the csa operon, an isolated nucleic acid encoding the csa operon or functional fragments thereof, purified polypeptide products of the csa operon or functional...
7384639 Methods of treating or preventing an infectious disease using an immunogenic conjugate of a gram-negative bacterial autoinducer molecule  
The present invention relates to an immunogenic conjugate comprising a carrier molecule coupled to an autoinducer of a Gram negative bacteria The immunogenic conjugate, when combined with a...
7371393 Methods for reducing fecal shedding  
The present invention provides methods for reducing shedding in an animal. Generally, the method includes administcriirn to an animal a composition including siderophore receptor polypeptides and...
7357935 Avian E. coli vaccine for protection against colibacillosis  
A genetic deletion mutant live E. coli vaccine suitable for mass application to poultry, including chickens, is provided. Also provided is a safe and effective method to protect poultry against...
7341732 Methods for treating mastitis in a milk producing animal  
The present invention provides methods for treating mastitis in a milk producing animal. The methods include administering compositions including siderophore receptor polypeptides and porins from...
7323179 Methods and compositions for the treatment and prevention of Staphylococcus and other bacterial infections  
The invention features methods and compositions for treatment or prevention of infection by, or disease caused by infection with, certain species of bacteria, including in particular bacteria in...
7320794 Transporter protein  
A novel protein which has an activity to transport hydantoin compounds is described, as well as a recombinant expressing this transporter protein. From Microbacterium liquefaciens strain AJ3912,...
7297338 Avian vaccine composition for the protection of poultry against disease and infection caused by E. coli and Salmonella  
There is provided a vaccine composition comprising a combination of a genetic deletion mutant S. typhimurium microorganism and a genetic deletion mutant E. coli microorganism, suitable for mass...
7291325 Method for producing target proteins by deleting or amplifying ibpA and/or ibpB gene coding for inclusion body-associated proteins  
A method for producing target proteins by deleting or amplifying ibpA and/or ibpB genes coding for inclusion body-associated proteins. Two methods for producing target proteins using ibpA and/or...
7208574 Host receptor for pathogenic bacteria  
A polypeptide, called Tir (for translocated intimin receptor, which is secreted by attaching and effacing pathogens, such as the enteropathogenic (EPEC) and enterohemorrhagic (EHEC) E. coli ....
7160549 Methods for making compositions including gram negative microbial polypeptides  
The present invention provides methods for making compositions including siderophore receptor polypeptides and porins from gram negative microbes. The methods include providing a gram negative...
7147857 Methods for treating high somatic cell counts  
The present invention provides methods for treating an animal having a high somatic cell count. The methods include administering compositions including siderophore receptor polypeptides and porins...
7138125 Methods for treating an animal for low milk production  
The present invention provides methods for treating an animal for low milk production. The methods include administering compositions including siderophore receptor polypeptides and porins from...
7138124 Polypeptides obtained from gram negative microbes  
The present invention provides compositions including at least two siderophore receptor polypeptides and at least two porins from a gram negative microbe, and preferably, lipopolysaccharide at a...
7118758 Transformed bacteria producing CS6 antigens as vaccines  
Disclosed herein are antigens that stimulate protective antibodies against enterotoxigenic Escherichia coli . Also disclosed herein are proteins encoded by cssA and cssB genes as well as...
7070781 Nontoxic mucosal adjuvant  
A non-toxic mucosal adjuvant is provided which may be admixed with further antigens to provide a vaccine administrable to mucosal surfaces in organisms including man. Preferably, the non-toxic...
7063852 Hybrid LT-A/CT-B holotoxin for use as an adjuvant  
The present invention provides a novel composition which is a hybrid heat labile enterotoxin comprising the A-subunit of the heat labile toxin of Escherichia coli (LT-A) and the B-subunit of the...
7056521 Detoxified mutants of bacterial ADP-ribosylating toxins as parenteral adjuvants  
The present invention provides parenteral adjuvants comprising detoxified mutants of bacterial ADP-ribosylating toxins, particularly those from pertussis (PT), cholera (CT), and heat-labile E....
7037510 Hybrids of M. tuberculosis antigens  
The present invention discloses fusion proteins of the immunodominant antigens ESAT-6 and Ag85B from Mycobacterium tuberculosis or homologues thereof, and a tuberculosis vaccine based on the...
7025971 Treatment or prophylaxis of diseases caused by pilus-forming bacteria  
Novel methods for the treatment and/or prophylaxis of diseases caused by tissue-adhering bacteria are disclosed. By interacting with periplasmic molecular chaperones it is achieved that the...
6942861 Histidine-tagged intimin and methods of using intimin to stimulate an immune response and as an antigen carrier with targeting capability  
The present invention describes the isolation and purification of histidine-tagged functional portions of intimin (his-tagged intimin or his-intimin), a protein associated with the ability of...
6913753 Incapacitated whole-cell immunogenic bacterial compositions  
The invention features incapacitated whole cell bacterial immunogenic compositions produced by infecting a bacterium with Lys minus bacteriophage, which are deficient in the lysin protein. Lys...
6905691 Vaccines containing attenuated bacteria  
The invention relates to a vaccine comprising a bacterium attenuated by a non-reverting mutation in a gene encoding a protein which promotes folding of extracytoplasmic proteins. Such mutations...
6872547 Functional balanced-lethal host-vector systems  
The invention encompasses methods of maintaining desired recombinant genes in a genetic population of cells expressing the desired gene. The methods utilize microbial cells that have an...
6793928 Vaccines with an LTB adjuvant  
The present invention relates to a vaccine containing at least one particulate immunogen and an adjuvanting amount of B subunits of heat-labile enterotoxin characteristic of E. Coli . More in...
6743607 Production of complex carbohydrates  
Compositions and methods for making complex carbohydrates in a bacterial production cell are disclosed. The complex carbohydrates that can be made include oligosaccharides and polysaccharides of...
6737063 FimH adhesin proteins and methods of use  
The present invention provides bacterial immunogenic agents for administration to humans and non-human animals to stimulate an immune response. Also provided are methods for vaccination of...
6638513 Neisseria meningitidis serogroup B Glycoconjugates  
The present invention pertains generally to Neisseria meningitidis serogroup B glycoconjugates. More particularly, the invention pertains to glycoconjugates formed from a Neisseria meningitidis ...
6613321 Live vaccines against gram-negative pathogens, expressing heterologous O-antigens  
The present invention relates to live attenuated gram-negative vaccine carrier strains which are useful for expression and delivery of heterologous O-antigens (O-PS) from gram-negative pathogens....
6610529 Recombinant bacterial system with environmentally limited viability  
Disclosed is an Environmentally Limited Viability System (ELVS) for microorganisms based on differences between permissive and non-permissive environments. Viability of the microorganisms are...
6596283 Meningococcal polysaccharide conjugate vaccines  
The invention relates to chemically-modified group B polysaccharides of Neisseria meningitidis . The invention also provides vaccines in which the respective modified polysaccharides are...
6558678 PREPARATION AND USE OF FORMALIN-KILLED COLONIZATION-FACTOR-ANTIGEN (CFA)-EXPRESSING E. COLI ORGANISMS FOR VACCINATION AGAINST ENTERIC INFECTION/DIARRHEA CAUSED BY ENTEROTOXIGENIC E. COLI BACTERIA IN HUMANS  
Disclosed is a method of producing a vaccine composition against enteric infection caused by enterotoxigenic E. coli bacteria in humans. E. coli strains selected from different known strains...
6500434 Chaperone and adhesin proteins; vaccines, diagnostics and method for treating infections  
The present invention provides bacterial immunogenic agents for administration to humans and non-human animals to stimulate an immune response. It particularly relates to the vaccination of...
6471966 Type 1 and type p fimbriae-adhesins isolated from novel e. coli strains, process for their preparation and uses thereof  
Fimbriae adhesins have a molecular weight of 2×10 5 and 2×10 7 Da, and are comprised of 90-95% protein and 1-3% sugar. Type 1 fimbriae include five different protein fractions of 14-20 kDa,...
6440423 Mutant enterotoxin effective as a non-toxic oral adjuvant  
Methods and compositions are provided herein for the se of a novel mutant form of E. coli heat-labile enterotoxin which has lost its toxicity but has retained its immunologic activity. This...
6420127 Compounds and pharmaceutical compositions for the treatment and prophylaxis of bacterial infections  
Novel methods for the treatment and/or prophylaxis of diseases caused by tissue-adhering bacteria are disclosed. By interacting with periplasmic molecular chaperones it is achieved that the...
6395964 Oral immunization with transgenic plants  
The oral antigens and adjuvants of the present invention are produced in transgenic plants and then administered through the consumption of the transgenic plant. DNA sequences both natural and...
6368604 Non-pyrogenic derivatives of lipid A  
The present inventors have found that certain preparations containing LPS and/or lipid A variants, derivatives, and/or analogs demonstrate non-pyrogenic properties and exhibit anti-viral...
6221386 Use of virulence factors of pathogens to improve liposomal delivery of therapeutic agents  
Liposome encapsulated antibiotic therapy has limited application against infectious organisms, which can sequester in non-phagocytic cells. Virulence factors of these infectious organisms, for...
6217883 Porcine circovirus and paravovirus vaccine  
The invention relates to antigenic preparations and vaccines directed against the porcine multisystemic wasting syndrome (PMWS), comprising at least one porcine circovirus antigen, preferably type...
6162433 Non antibiotic selectable markers for live vaccines  
The invention relates to DNA constructs encoding a safe, selectable marker, other than an antibiotic resistance marker, vectors and/or cells including said constructs; and vaccines based on said...
6149919 Immunogenic detoxified mutants of cholera toxin and of the toxin LT, their preparation and their use for the preparation of vaccines  
An immunogenic detoxified protein comprising the amino acid sequence of subunit A of cholera toxin (CT-A) or subunit A of an Escherichia coli heat labile toxin (LT-A) or a fragment thereof wherein...
6121296 Transition-state inhibitors for nucleoside hydrolase and transferase reactions  
This invention is directed to transition-state analog compounds and to the use of said compounds as inhibitors of nucleoside hydrolase and transferase enzyme activity of parasites. This invention...
Matches 1 - 50 out of 147 1 2 3 >