|
Match
|
Document |
Document Title |
|
|
7632513 |
Immunogenic detoxified mutants of cholera toxin
An immunogenic detoxified protein comprising the amino acid sequence of subunit A of a cholera toxin (CT-A) or a fragment thereof or the amino acid sequence of subunit A of an Escherichia coli ...
|
|
|
7625571 |
Transformed bacteria producing CS6 antigens as vaccines
Disclosed herein are antigens that stimulate protective antibodies against enterotoxigenic Escherichia coli . Also disclosed herein are proteins encoded by cssA and cssB genes as well as...
|
|
|
7527802 |
Vaccine for transcutaneous immunization
A vaccine delivered by transcutaneous immunization provides an effective treatment against infections by pathogens such as, for example, enterotoxigenic Escherichia coli (ETEC) and/or for...
|
|
|
7521059 |
Kennel cough vaccine
Improved, low cost vaccines for administration to living subjects such as mammals and birds are provided, which include killed recombinantly modified microorganisms (whole cell recombinant bacterin...
|
|
|
7422752 |
Mutant forms of EtxB and CtxB and their use as carriers
The present invention describes the use of a mutant form of EtxB or CtxB to deliver an agent to a target cell wherein the mutant has GM-1 binding activity; but wherein the mutant has a reduced...
|
|
|
7404961 |
Peptides responsive to antibodies against consensus peptide of the CS4-CFA/I family proteins
This invention relates to amino acid sequences from within a consensus peptide of the formula:
VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID. NO: 1)
Eight mer peptides from within the...
|
|
|
7371393 |
Methods for reducing fecal shedding
The present invention provides methods for reducing shedding in an animal. Generally, the method includes administcriirn to an animal a composition including siderophore receptor polypeptides and...
|
|
|
7341732 |
Methods for treating mastitis in a milk producing animal
The present invention provides methods for treating mastitis in a milk producing animal. The methods include administering compositions including siderophore receptor polypeptides and porins from...
|
|
|
7332172 |
Transformed bacteria producing CS6 antigens as vaccines
Disclosed herein are antigens that stimulate protective antibodies against enterotoxigenic Escherichia coli . Also disclosed herein are proteins encoded by cssA and cssB genes as well as...
|
|
|
7323179 |
Methods and compositions for the treatment and prevention of Staphylococcus and other bacterial infections
The invention features methods and compositions for treatment or prevention of infection by, or disease caused by infection with, certain species of bacteria, including in particular bacteria in...
|
|
|
7309493 |
Inactivated bovine scours vaccines, process and method of preventing bovine scours
Inactivated scours vaccines for immunization and protection of bovine animals from disease caused by infection with bovine rotavirus and bovine coronavirus, which comprise and effective amount of...
|
|
|
7214499 |
Pathogenic Escherichia coli associated protein
The present invention provides a polypeptide, called EspA, which is secreted by pathogenic E. coli , such as the enteropathogenic (SPEC) and enterohemorrhagic (EHEC) E. coli . The invention also...
|
|
|
7189557 |
Process for the intracellular over-production of streptokinase using genetically engineered strain of E. coli
An improved process for the production of streptokinase using a genetically engineered strain of Escherichia coli which overproduces streptokinase intracellularly and more particularly, the...
|
|
|
7160549 |
Methods for making compositions including gram negative microbial polypeptides
The present invention provides methods for making compositions including siderophore receptor polypeptides and porins from gram negative microbes. The methods include providing a gram negative...
|
|
|
7147857 |
Methods for treating high somatic cell counts
The present invention provides methods for treating an animal having a high somatic cell count. The methods include administering compositions including siderophore receptor polypeptides and porins...
|
|
|
7138125 |
Methods for treating an animal for low milk production
The present invention provides methods for treating an animal for low milk production. The methods include administering compositions including siderophore receptor polypeptides and porins from...
|
|
|
7138124 |
Polypeptides obtained from gram negative microbes
The present invention provides compositions including at least two siderophore receptor polypeptides and at least two porins from a gram negative microbe, and preferably, lipopolysaccharide at a...
|
|
|
7118758 |
Transformed bacteria producing CS6 antigens as vaccines
Disclosed herein are antigens that stimulate protective antibodies against enterotoxigenic Escherichia coli . Also disclosed herein are proteins encoded by cssA and cssB genes as well as...
|
|
|
7097845 |
Combinations of antigen and mucosal binding component for inducing specific immunological tolerance
This invention provides combinations of a tolerance-inducing antigen such as insulin and a mucosal binding component that preferably binds ganglioside GM1. The components are present in a...
|
|
|
7056521 |
Detoxified mutants of bacterial ADP-ribosylating toxins as parenteral adjuvants
The present invention provides parenteral adjuvants comprising detoxified mutants of bacterial ADP-ribosylating toxins, particularly those from pertussis (PT), cholera (CT), and heat-labile E....
|
|
|
7037499 |
Adjuvant for transcutaneous immunization
A transcutaneous immunization system delivers antigen to immune cells without perforation of the skin, and induces an immune response in an animal or human. The system uses an adjuvant, preferably...
|
|
|
7025971 |
Treatment or prophylaxis of diseases caused by pilus-forming bacteria
Novel methods for the treatment and/or prophylaxis of diseases caused by tissue-adhering bacteria are disclosed. By interacting with periplasmic molecular chaperones it is achieved that the...
|
|
|
7014857 |
Anti-sepsis conjugate vaccine
The present invention provides an immunogenic conjugate comprising biologically deacylated gram-negative bacterial moieties linked to D. discoideum proteinase 1, as well as novel subunits...
|
|
|
6974577 |
Inactivated bovine scours vaccines, processes and method of preventing bovine scours
Inactivated scours vaccines for immunization and protection of bovine animals from disease caused by infection with bovine rotavirus and bovine coronavirus, which comprise and effective amount of...
|
|
|
6951652 |
Vaccine for prevention of gram-negative bacterial infections and endotoxin related diseases
A vaccine is disclosed which is useful for protecting a host from Gram negative infections and the effects of endotoxin, therefore preventing sepsis and septic shock. The vaccine is prepared by...
|
|
|
6841345 |
Treatment and prevention of immunodeficiency virus infection by administration of non-pyrogenic derivatives of lipid A
The present inventors have found that certain preparations containing LPS and/or lipid A variants, derivatives, and/or analogs demonstrate non-pyrogenic properties and exhibit anti-viral...
|
|
|
6833451 |
Lipopolysaccharides (LPS) extracted from Escherichia coli
Lipopolysaccharides and processes for producting the lipopolysaccharides are provided. The lipopolysaccharide has a lipid A portion, a core oligosaccharide portion, and an O-specific chain having a...
|
|
|
6824997 |
Process and materials for the rapid detection of streptococcus pneumoniae employing purified antigen-specific antibodies
A process is disclosed for obtaining a C-polysaccharide cell wall antigen containing not more than about 10% protein from Streptococcus pneumoniae bacteria. The antigen thus obtained is...
|
|
|
6797276 |
Use of penetration enhancers and barrier disruption agents to enhance the transcutaneous immune response
A transcutaneous immunization system where the topical application of an adjuvant and an antigen or nucleic acid encoding for an antigen, to intact skin induces a ystemic or mucosol antibody...
|
|
|
6793928 |
Vaccines with an LTB adjuvant
The present invention relates to a vaccine containing at least one particulate immunogen and an adjuvanting amount of B subunits of heat-labile enterotoxin characteristic of E. Coli . More in...
|
|
|
6790446 |
Campylobacter vaccine
The present invention relates to vaccines comprising antiserum raised against a flagellaless Campylobacter strain for the prevention of Campylobacter colonization in animals. The invention also...
|
|
|
6780414 |
METHODS OF IDENTIFYING BACTERIAL GENES THAT ARE INCOMPATIBLE WITH BACTERIAL PATHOGENICITY, AND THE USE OF SUCH GENES, SUCH AS CADA, TO REDUCE PATHOGENICITY IN A BACTERIA OR TO COMBAT PATHOGENIC BACTERIAL INFECTIONS
“Black holes” in the genomes of bacterial pathogens represent deletions of “anti-virulence” genes, i.e. genes that are detrimental to a pathogenic lifestyle. Identification of the missing...
|
|
|
6764687 |
Live attenuated bacteria for use in a vaccine
The present invention relates to live attenuated bacteria for use as a medicament. The invention also relates to vaccines based thereon that are useful for the prevention of microbial pathogenesis....
|
|
|
6749831 |
Vaccine against lipopolysaccharide core
Compare core LPS (lacking O-polysaccharide side chains) from Gram-negative bacteria are incorporated into a vaccine typically in liposomes. The complete core of E. coli K 12 is particularly...
|
|
|
6696065 |
Acellular pertussis vaccines and methods of preparation thereof
A multi-component vaccine composition is described comprising acellular pertussis vaccine components, diphtheria toxoid, tetanus toxoid and inactivated poliovirus. The composition also may contain...
|
|
|
6635259 |
Escherichia coli secreted protein B
Several EHEC proteins which are secreted into the culture supernatant have been discovered. These proteins are not produced by non-pathogenic E. coli , and produce a strong serum antibody response...
|
|
|
6632437 |
Immunogenic polysaccharide-protein conjugates containing poly α(2→8), α(2→9) NeuNAc capsular polysaccharides
The present invention relates to a polysaccharide-protein conjugate. The invention also relates to a method of using the conjugate to prevent systemic infections. The invention further relates to a...
|
|
|
6548287 |
Non-pyrogenic bacterial strains and use of the same
The present invention provides gram-negative bacterial strains that produce substantially pure non-pyrogenic lipopolysaccharide or lipid A. The present invention also relates to a use of said...
|
|
|
6541013 |
Methods and compositions for suppressing bovine leukemia virus with a Shiga toxin polypeptide
The present invention provides methods and compositions for suppressing bovine leukemia-related cell proliferation. In the methods, a Shiga-toxin composition is administered in an amount effective...
|
|
|
6537558 |
Methods of producing and using virulence attenuated poxR mutant bacteria
Disclosed are bacteria having virulence attenuated by a mutation to the regulatory gene poxR. Also disclosed is a method of producing bacteria having virulence attenuated by mutating to the...
|
|
|
6517829 |
Products comprising inactivated yeasts or moulds provided with active antibodies
New products are provided comprising inactivated lower eukaryotic cells, preferably yeasts or molds, having at the outer surface functionally active antibodies or functionally active fragments...
|
|
|
6500434 |
Chaperone and adhesin proteins; vaccines, diagnostics and method for treating infections
The present invention provides bacterial immunogenic agents for administration to humans and non-human animals to stimulate an immune response. It particularly relates to the vaccination of...
|
|
|
6486132 |
Immunomodulator, immunomodulator food and immunomodulator feed
To provide an immunomodulator in which DNA can be administered orally or percutaneously, not through injection, or can be taken daily like a food, or an immunomodulator food or feed. DNA derived...
|
|
|
6471966 |
Type 1 and type p fimbriae-adhesins isolated from novel e. coli strains, process for their preparation and uses thereof
Fimbriae adhesins have a molecular weight of 2×10 5 and 2×10 7 Da, and are comprised of 90-95% protein and 1-3% sugar. Type 1 fimbriae include five different protein fractions of 14-20 kDa,...
|
|
|
6440423 |
Mutant enterotoxin effective as a non-toxic oral adjuvant
Methods and compositions are provided herein for the se of a novel mutant form of E. coli heat-labile enterotoxin which has lost its toxicity but has retained its immunologic activity. This...
|
|
|
6420127 |
Compounds and pharmaceutical compositions for the treatment and prophylaxis of bacterial infections
Novel methods for the treatment and/or prophylaxis of diseases caused by tissue-adhering bacteria are disclosed. By interacting with periplasmic molecular chaperones it is achieved that the...
|
|
|
6413523 |
Pharmaceutical composition of escherichia coli heat-labile enterotoxin adjuvant and methods of use
Novel immunoregulatory utilities of Escherichi coli heat-labile enterotoxin (LT) are disclosed. This enterotoxin can be used in combination with an unrelated antigen to achieve a higher immune...
|
|
|
6403093 |
Methods to detect granulocytic ehrlichiosis
An isolated nucleic acid molecule associated with human granulocytic ehrlichiosis is provided. Also provided are methods to detect the presence of the nucleic acid molecule, and antibodies specific...
|
|
|
6379676 |
Enhancing immune response in animals
A method for improving the immune response of an animal to a vaccine, comprising: feeding an animal a diet of contamination-resistant feed, and treating said animal with an anti-viral or...
|
|
|
6365163 |
Immunological tolerance-inducing agent
An agent comprising a mucosa-binding molecule linked to a specific microbial antigen is disclosed. Further, a method of inducing immnunological tolerance in an individual against a specific...
|