Matches 1 - 50 out of 99 1 2 >
Match Document Document Title
7632513 Immunogenic detoxified mutants of cholera toxin  
An immunogenic detoxified protein comprising the amino acid sequence of subunit A of a cholera toxin (CT-A) or a fragment thereof or the amino acid sequence of subunit A of an Escherichia coli ...
7625571 Transformed bacteria producing CS6 antigens as vaccines  
Disclosed herein are antigens that stimulate protective antibodies against enterotoxigenic Escherichia coli . Also disclosed herein are proteins encoded by cssA and cssB genes as well as...
7527802 Vaccine for transcutaneous immunization  
A vaccine delivered by transcutaneous immunization provides an effective treatment against infections by pathogens such as, for example, enterotoxigenic Escherichia coli (ETEC) and/or for...
7521059 Kennel cough vaccine  
Improved, low cost vaccines for administration to living subjects such as mammals and birds are provided, which include killed recombinantly modified microorganisms (whole cell recombinant bacterin...
7422752 Mutant forms of EtxB and CtxB and their use as carriers  
The present invention describes the use of a mutant form of EtxB or CtxB to deliver an agent to a target cell wherein the mutant has GM-1 binding activity; but wherein the mutant has a reduced...
7404961 Peptides responsive to antibodies against consensus peptide of the CS4-CFA/I family proteins  
This invention relates to amino acid sequences from within a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID. NO: 1) Eight mer peptides from within the...
7371393 Methods for reducing fecal shedding  
The present invention provides methods for reducing shedding in an animal. Generally, the method includes administcriirn to an animal a composition including siderophore receptor polypeptides and...
7341732 Methods for treating mastitis in a milk producing animal  
The present invention provides methods for treating mastitis in a milk producing animal. The methods include administering compositions including siderophore receptor polypeptides and porins from...
7332172 Transformed bacteria producing CS6 antigens as vaccines  
Disclosed herein are antigens that stimulate protective antibodies against enterotoxigenic Escherichia coli . Also disclosed herein are proteins encoded by cssA and cssB genes as well as...
7323179 Methods and compositions for the treatment and prevention of Staphylococcus and other bacterial infections  
The invention features methods and compositions for treatment or prevention of infection by, or disease caused by infection with, certain species of bacteria, including in particular bacteria in...
7309493 Inactivated bovine scours vaccines, process and method of preventing bovine scours  
Inactivated scours vaccines for immunization and protection of bovine animals from disease caused by infection with bovine rotavirus and bovine coronavirus, which comprise and effective amount of...
7214499 Pathogenic Escherichia coli associated protein  
The present invention provides a polypeptide, called EspA, which is secreted by pathogenic E. coli , such as the enteropathogenic (SPEC) and enterohemorrhagic (EHEC) E. coli . The invention also...
7189557 Process for the intracellular over-production of streptokinase using genetically engineered strain of E. coli  
An improved process for the production of streptokinase using a genetically engineered strain of Escherichia coli which overproduces streptokinase intracellularly and more particularly, the...
7160549 Methods for making compositions including gram negative microbial polypeptides  
The present invention provides methods for making compositions including siderophore receptor polypeptides and porins from gram negative microbes. The methods include providing a gram negative...
7147857 Methods for treating high somatic cell counts  
The present invention provides methods for treating an animal having a high somatic cell count. The methods include administering compositions including siderophore receptor polypeptides and porins...
7138125 Methods for treating an animal for low milk production  
The present invention provides methods for treating an animal for low milk production. The methods include administering compositions including siderophore receptor polypeptides and porins from...
7138124 Polypeptides obtained from gram negative microbes  
The present invention provides compositions including at least two siderophore receptor polypeptides and at least two porins from a gram negative microbe, and preferably, lipopolysaccharide at a...
7118758 Transformed bacteria producing CS6 antigens as vaccines  
Disclosed herein are antigens that stimulate protective antibodies against enterotoxigenic Escherichia coli . Also disclosed herein are proteins encoded by cssA and cssB genes as well as...
7097845 Combinations of antigen and mucosal binding component for inducing specific immunological tolerance  
This invention provides combinations of a tolerance-inducing antigen such as insulin and a mucosal binding component that preferably binds ganglioside GM1. The components are present in a...
7056521 Detoxified mutants of bacterial ADP-ribosylating toxins as parenteral adjuvants  
The present invention provides parenteral adjuvants comprising detoxified mutants of bacterial ADP-ribosylating toxins, particularly those from pertussis (PT), cholera (CT), and heat-labile E....
7037499 Adjuvant for transcutaneous immunization  
A transcutaneous immunization system delivers antigen to immune cells without perforation of the skin, and induces an immune response in an animal or human. The system uses an adjuvant, preferably...
7025971 Treatment or prophylaxis of diseases caused by pilus-forming bacteria  
Novel methods for the treatment and/or prophylaxis of diseases caused by tissue-adhering bacteria are disclosed. By interacting with periplasmic molecular chaperones it is achieved that the...
7014857 Anti-sepsis conjugate vaccine  
The present invention provides an immunogenic conjugate comprising biologically deacylated gram-negative bacterial moieties linked to D. discoideum proteinase 1, as well as novel subunits...
6974577 Inactivated bovine scours vaccines, processes and method of preventing bovine scours  
Inactivated scours vaccines for immunization and protection of bovine animals from disease caused by infection with bovine rotavirus and bovine coronavirus, which comprise and effective amount of...
6951652 Vaccine for prevention of gram-negative bacterial infections and endotoxin related diseases  
A vaccine is disclosed which is useful for protecting a host from Gram negative infections and the effects of endotoxin, therefore preventing sepsis and septic shock. The vaccine is prepared by...
6841345 Treatment and prevention of immunodeficiency virus infection by administration of non-pyrogenic derivatives of lipid A  
The present inventors have found that certain preparations containing LPS and/or lipid A variants, derivatives, and/or analogs demonstrate non-pyrogenic properties and exhibit anti-viral...
6833451 Lipopolysaccharides (LPS) extracted from Escherichia coli  
Lipopolysaccharides and processes for producting the lipopolysaccharides are provided. The lipopolysaccharide has a lipid A portion, a core oligosaccharide portion, and an O-specific chain having a...
6824997 Process and materials for the rapid detection of streptococcus pneumoniae employing purified antigen-specific antibodies  
A process is disclosed for obtaining a C-polysaccharide cell wall antigen containing not more than about 10% protein from Streptococcus pneumoniae bacteria. The antigen thus obtained is...
6797276 Use of penetration enhancers and barrier disruption agents to enhance the transcutaneous immune response  
A transcutaneous immunization system where the topical application of an adjuvant and an antigen or nucleic acid encoding for an antigen, to intact skin induces a ystemic or mucosol antibody...
6793928 Vaccines with an LTB adjuvant  
The present invention relates to a vaccine containing at least one particulate immunogen and an adjuvanting amount of B subunits of heat-labile enterotoxin characteristic of E. Coli . More in...
6790446 Campylobacter vaccine  
The present invention relates to vaccines comprising antiserum raised against a flagellaless Campylobacter strain for the prevention of Campylobacter colonization in animals. The invention also...
6780414 METHODS OF IDENTIFYING BACTERIAL GENES THAT ARE INCOMPATIBLE WITH BACTERIAL PATHOGENICITY, AND THE USE OF SUCH GENES, SUCH AS CADA, TO REDUCE PATHOGENICITY IN A BACTERIA OR TO COMBAT PATHOGENIC BACTERIAL INFECTIONS  
“Black holes” in the genomes of bacterial pathogens represent deletions of “anti-virulence” genes, i.e. genes that are detrimental to a pathogenic lifestyle. Identification of the missing...
6764687 Live attenuated bacteria for use in a vaccine  
The present invention relates to live attenuated bacteria for use as a medicament. The invention also relates to vaccines based thereon that are useful for the prevention of microbial pathogenesis....
6749831 Vaccine against lipopolysaccharide core  
Compare core LPS (lacking O-polysaccharide side chains) from Gram-negative bacteria are incorporated into a vaccine typically in liposomes. The complete core of E. coli K 12 is particularly...
6696065 Acellular pertussis vaccines and methods of preparation thereof  
A multi-component vaccine composition is described comprising acellular pertussis vaccine components, diphtheria toxoid, tetanus toxoid and inactivated poliovirus. The composition also may contain...
6635259 Escherichia coli secreted protein B  
Several EHEC proteins which are secreted into the culture supernatant have been discovered. These proteins are not produced by non-pathogenic E. coli , and produce a strong serum antibody response...
6632437 Immunogenic polysaccharide-protein conjugates containing poly α(2→8), α(2→9) NeuNAc capsular polysaccharides  
The present invention relates to a polysaccharide-protein conjugate. The invention also relates to a method of using the conjugate to prevent systemic infections. The invention further relates to a...
6548287 Non-pyrogenic bacterial strains and use of the same  
The present invention provides gram-negative bacterial strains that produce substantially pure non-pyrogenic lipopolysaccharide or lipid A. The present invention also relates to a use of said...
6541013 Methods and compositions for suppressing bovine leukemia virus with a Shiga toxin polypeptide  
The present invention provides methods and compositions for suppressing bovine leukemia-related cell proliferation. In the methods, a Shiga-toxin composition is administered in an amount effective...
6537558 Methods of producing and using virulence attenuated poxR mutant bacteria  
Disclosed are bacteria having virulence attenuated by a mutation to the regulatory gene poxR. Also disclosed is a method of producing bacteria having virulence attenuated by mutating to the...
6517829 Products comprising inactivated yeasts or moulds provided with active antibodies  
New products are provided comprising inactivated lower eukaryotic cells, preferably yeasts or molds, having at the outer surface functionally active antibodies or functionally active fragments...
6500434 Chaperone and adhesin proteins; vaccines, diagnostics and method for treating infections  
The present invention provides bacterial immunogenic agents for administration to humans and non-human animals to stimulate an immune response. It particularly relates to the vaccination of...
6486132 Immunomodulator, immunomodulator food and immunomodulator feed  
To provide an immunomodulator in which DNA can be administered orally or percutaneously, not through injection, or can be taken daily like a food, or an immunomodulator food or feed. DNA derived...
6471966 Type 1 and type p fimbriae-adhesins isolated from novel e. coli strains, process for their preparation and uses thereof  
Fimbriae adhesins have a molecular weight of 2×10 5 and 2×10 7 Da, and are comprised of 90-95% protein and 1-3% sugar. Type 1 fimbriae include five different protein fractions of 14-20 kDa,...
6440423 Mutant enterotoxin effective as a non-toxic oral adjuvant  
Methods and compositions are provided herein for the se of a novel mutant form of E. coli heat-labile enterotoxin which has lost its toxicity but has retained its immunologic activity. This...
6420127 Compounds and pharmaceutical compositions for the treatment and prophylaxis of bacterial infections  
Novel methods for the treatment and/or prophylaxis of diseases caused by tissue-adhering bacteria are disclosed. By interacting with periplasmic molecular chaperones it is achieved that the...
6413523 Pharmaceutical composition of escherichia coli heat-labile enterotoxin adjuvant and methods of use  
Novel immunoregulatory utilities of Escherichi coli heat-labile enterotoxin (LT) are disclosed. This enterotoxin can be used in combination with an unrelated antigen to achieve a higher immune...
6403093 Methods to detect granulocytic ehrlichiosis  
An isolated nucleic acid molecule associated with human granulocytic ehrlichiosis is provided. Also provided are methods to detect the presence of the nucleic acid molecule, and antibodies specific...
6379676 Enhancing immune response in animals  
A method for improving the immune response of an animal to a vaccine, comprising: feeding an animal a diet of contamination-resistant feed, and treating said animal with an anti-viral or...
6365163 Immunological tolerance-inducing agent  
An agent comprising a mucosa-binding molecule linked to a specific microbial antigen is disclosed. Further, a method of inducing immnunological tolerance in an individual against a specific...
Matches 1 - 50 out of 99 1 2 >