Matches 1 - 50 out of 176 1 2 3 4 >
Match Document Document Title
7378096 Stress protein compositions and methods for prevention and treatment of cancer and infectious disease  
Pharmaceutical compositions comprising a stress protein complex and related molecules encoding or cells presenting such a complex are provided. The stress protein complex comprises an hsp110 or...
7341730 Inhibitors of angiogenesis and tumor growth  
This invention provides for polypeptides that have surprising anti-angiogenic activity. These peptides are derived from Saposin B, a previously known protein involved in the hydrolysis of...
7320793 Molecular antigen array  
The present invention is related to the fields of molecular biology, virology, immunology and medicine. The invention provides a composition comprising an ordered and repetitive antigen or...
7311892 Multidrug multiligand conjugates for targeted drug delivery  
Described is a multi drug multiligand conjugate for targeted drug delivery. The MDML conjugate contains a plurality of tripartite molecules linked to a central scaffold moiety, with each tripartite...
7270822 Active complex of alpha-lactalbumin (hamlet) and cofactor  
The use of a biologically active complex of α-lactalbumin, selected from HAMLET (human α-lactalbumin made lethal to tumour cells) or a biologically active modification thereof, or a biologically...
7208157 Proteolysis targeting chimeric pharmaceutical  
The present invention is based on the discovery of a composition that provides targeted ubiquitination. Specifically the composition contains a ubiquitin pathway protein binding moiety which...
7201905 Bi-functional cancer treatment agents  
A novel fusion protein, comprising a receptor-antagonizing domain and a positive immunomodulator domain, characterized, for example, by its ability to block apoptosis and/or inhibit endocrine...
7138494 Sodium-independent small neutral amino acid transporter transporting L- and D-amino acids  
Novel sodium-independent small neutral amino acid transporters which transport L- and D-amino acids. A protein comprising the amino acid sequence represented by SEQ ID NO:1 or 4 or an amino acid...
7128913 Erythropoietin conjugates  
The present invention refers to conjugates of erythropoietin with poly(ethylene glycol) comprising an erythropoietin glycoprotein having an N-terminal α-amino group and having the in vivo...
7128911 Antigen arrays for treatment of bone disease  
The present invention is related to the fields of molecular biology, virology, immunology and medicine. The invention provides a composition comprising an ordered and repetitive antigen or...
7128903 Pharmaceutical preparations useful for treating tumors and lesions of the skin and the mucous membranes and methods and kits using same  
A pharmaceutical preparation useful for treating a skin or mucous membrane lesion is provided. The pharmaceutical preparation including, as active ingredients, a therapeutically effective amount of...
7115266 Angiotensin peptide-carrier conjugates and uses thereof  
The present invention provides conjugates of peptide derivatives of the mammalian peptide hormones angiotensinogen, angiotensin I and angiotensin II, presented in a repetitive scaffold by coupling...
7105162 Pharmaceutical composition for immunomodulation based on peptides and adjuvants  
Pharmaceutical composition containing at least one peptide or protein (fragment) with an immunomodulatory activity together with an adjuvant. The peptide is derived from a pathogenic agent or a...
7087232 Process for producing a culture of Antrodia camphorata and product obtained thereby  
The present invention relates to the establishment of a cultivation condition that is suitable for the large-scale production of pharmacologically active filtrates from a culture of A. camphorata...
7056512 Method for down-regulating GDF-8 activity  
Disclosed are novel methods for increasing muscle mass by means of immunization against Growth Differentiation Factor 8 (GDF-8, myostatin). Immunization is preferably effected by administration of...
7038016 Methods for purification of an activated PEG solution and for the synthesis of a modified hemoglobin solution  
The present invention employs a dissolved activated polyethylene glycol (aPEG) or related molecule that has been passed through a filtration means for the substantial reduction of bioburden or...
7037501 Myostatin immnoconjugate  
A method to alter the phenotype of animals, e.g., avians, which employs passive and active immunization is provided.
7022521 Methods and compositions for treating platelet-related disorders using MPL pathway inhibitory agents  
The invention relates to the treatment of subjects for the purpose inhibiting vaso-occlusive events, including thrombosis and embolism, by administering agents which reduce the number of...
7014856 Ganglioside-KLH conjugate vaccines plus OS-21  
This invention provides a vaccine for stimulating or enhancing in a subject to which the vaccine is administered, production of an antibody which recognizes a ganglioside, comprising an amount of...
7001601 Ganglioside-KLH conjugate vaccine plus QS-21  
This invention provides a vaccine for stimulating or enhancing in a subject to which the vaccine is administered, production of an antibody which recognizes a ganglioside, comprising an amount of...
6998125 Synergistic composition and methods for treating neoplastic or cancerous growths and for restoring or boosting hematopoiesis  
The present invention provides a synergistic composition and methods for treating neoplastic or cancerous growths as well as for treating such patients in order to restore or boost hematopoiesis....
6967022 Ganglioside-KLH conjugate vaccines plus QS-21  
This invention provides a vaccine for stimulating or enhancing in a subject to which the vaccine is administered, production of an antibody which recognizes a ganglioside, comprising an amount of...
6962694 Cytolysis of target cells by superantigen conjugates inducing T-cell activation  
A method for inactivating target cells in the presence of T cells by bringing the two types of cells in contact with a superantigen (SAG) in the presence of an immune modulator, characterized in...
6942663 Laser treatment of cutaneous vascular lesions  
Methods for treating maladies such as cutaneous vascular lesions. A patient in need of vascular lesion treatment is identified. A hyperosmotic agent is administered to a region adjacent the lesion....
6929797 Targeted therapeutic delivery of vitamin D compounds  
The present invention is directed to a conjugate which includes at least one vitamin D moiety thereof and at least one targeting molecule moiety to pharmaceutical compositions of the conjugate, and...
6916476 Ganglioslide-KLH conjugate vaccine plus QS-21  
This invention provides a vaccine for stimulating or enhancing in a subject to which the vaccine is administered, production of an antibody which recognizes a ganglioside, comprising an amount of...
6888016 Mixtures for stimulating glucose up-take  
Our invention concerns a mixture of CLA glycerides, and/or CLA-fatty acids and or CLA-alkyl esters and another component, wherein the other component (=component A) is selected for its capacity to...
6866848 Antigenic polypetide sequence of factor VIII, fragments and/or epitopes there of  
An antigenic polypeptide of factor VIII comprises a polypeptide included between the Glutamic Acid 1649 and Asparagine 2019, preferably between Arginine 1652 and Arginine 1917 of the polypeptide of...
6841160 Meningococcal vaccines formulated with interleukin-12  
This invention pertains to vaccine compositions comprising a mixture of antigen, such as pneumococcal or meningococcal antigen, and interleukin IL-12, which may be adsorbed onto a mineral in...
6831059 Compositions and methods for treating gonadotrophin related illnesses  
The present invention relates to an agent comprising a neurotoxin, methods for making the agents and methods for treating endocrine disorders, for example gonadotrophin related illnesses....
6827937 HBV capsid-binding peptide immunogens  
This invention relates to hepatitis B virus (“HBV”) core antigen particles that are characterized by multiple immunogen specificities. More particularly, the invention relates to HBV core...
6805865 Compositions and methods for treating cancer and hyperproliferative disorders  
Compositions and methods effective for eliciting an immune response for inhibiting abnormal or undesirable cell proliferation, particularly endothelial cell proliferation and angiogenesis related...
6797806 Fragments of CR1 and their use  
A polypeptide comprising a portion of the sequence of the general formula (I): CNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSG, of 6-23 amino acids in length and comprising sequence a) and/or b): a) GGRKVF, b)...
6797275 Method of immunizing humans against Salmonella typhi using a Vi-rEPA conjugate vaccine  
This invention relates to conjugates of the Vi polysaccharide of S. typhi with the carrier Pseudomonas aeruginosa recombinant exoprotein A (rEPA), and compositions thereof, and to methods of...
6773707 Heat shock protein-based vaccines and immunotherapies  
The present invention relates to methods and compositions for inducing an immune response in a subject, wherein the subject is administered an effective amount of a heat shock protein complexed to...
6737064 Method for the diagnosis of neoplastic tissue comprising administering a vasopermeability enhancing peptide of human interleukin-2  
A novel permeability enhancing peptide (PEP) is a fragment of interleukin-2. When joined to a delivery vehicle that can target a tumor site, the PEP can increase the subsequent uptake of...
6730302 Intracellular targeted delivery of compounds by 70 kD heat shock protein  
The present invention provides a carrier for the delivery of molecules with biological function into both cellular and nuclear compartments. The carrier disclosed is heat shock protein 70...
6709658 Pneumococcal vaccines formulated with interleukin-12  
This invention pertains to vaccine compositions comprising a mixture of antigen, such as a pneumococcal or meningococcal antigen, and interleukin IL-12, which may be adsorbed onto a mineral in...
6703238 Methods for expanding antigen-specific T cells  
Methods for expanding antigen-specific T cells in vitro are provided. The methods involve contacting hematopoietic precursor or progenitor cells with a heteroconjugate containing an inhibitor of...
6699656 Treatment and prevention of HIV infection by administration of derivatives of human chorionic gonadotropin  
The present invention relates to β-hCG, particularly β-hCG proteins having a sequence of amino acids 41-54, 45-54, 47-53, 45-57 and 45-58 and analogs and derivatives thereof. The invention...
6680058 Compositions and methods for contraception in or sterilization of mammals  
Amphipathic lytic peptides are ideally suited to use in a ligand/cytotoxin combination to induce sterility or long-term contraception in mammals. The peptides act directly on cell membranes, and...
6676941 Antibody conjugate formulations for selectively inhibiting VEGF  
Disclosed are antibodies that specifically inhibit VEGF binding to only one (VEGFR2) of the two VEGF receptors. The antibodies effectively inhibit angiogenesis and induce tumor regression, and yet...
6660271 Ubiquitin fusion-based vaccine system  
Disclosed are epitope-containing heat shock fusion proteins, DNA constructs encoding such fusion proteins, and methods of use. More specifically, disclosed are ubiquitin fusion proteins comprising...
6652864 Compounds for intracellular delivery of therapeutic moieties to nerve cells  
A compound for delivering a non-cytotoxic therapeutic moiety into nerve cells, the compound having the general formula: B—L—TM where: B is a binding agent capable of selectively binding to a...
6645501 Anti-pathogen system and methods of use thereof  
The present invention provides an anti-pathogen system comprising one or more fusion proteins that includes a transduction domain and a cytotoxic domain. The cytotoxic domain is specifically...
6627200 Utilization of CD 137 in order to promote the proliferation of peripheral monocytes  
The invention relates to the utilization of monocytes growth factor CD137 or of a functional analogue thereof in order to produce a medicament for promoting the proliferation of peripheral...
6599507 Composition for the treatment of immune deficiencies and methods for its preparation and use  
A complex of alpha-fetoprotein (AFP) and N-arachidonoyl aminoethyl phosphate (N-AAP) is shown to have significant immunostimulating properties and can therefore be used as a therapeutic agent in...
6593461 Adherence gene from Helicobacter pylori and polypeptide coded thereby  
The present invention concerns an adherence gene from Helicobacter pylori , a polypeptide coded thereby and antibodies against the polypeptide.
6592872 Targeting antigens to the MHC class I processing pathway with an anthrax toxin fusion protein  
The present invention provides a vaccine for inducing an immune response in mammal to a specific antigen, where the vaccine comprises a unit dose of a binary, cytotoxic T lymphocyte vaccine...
6583272 Erythropoietin conjugates  
Conjugates of erythropoietin with poly(ethylene glycol) comprise an erythropoietin glycoprotein having at least one free amino group and having the in vivo biological activity of causing bone...
Matches 1 - 50 out of 176 1 2 3 4 >